Agent G2 - Active Directory Free System Page Table Entries DotNet v4

Description

Monitors Active Directory Free System Page Table Entries Counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Active Directory Free System Page Table Entries DotNet v4AD_Free_System_Page_Table_EntriesFreeSystemPageTableEntriesNULLFree System Page Table Entries is the number of page table entries not currently in used by the system. This counter displays the last observed value only; it is not an average

Agent G2 - Active Directory Performance Counters DotNet v4

Description

Monitors AD Performance data

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Active Directory Performance Counters DotNet v4DRAInboundObjectsPersecDRAInboundObjectsPersecNULLThe number of objects received (per second) through inbound replication from replication partners.
DSServerBindsPersecDSServerBindsPersecNULLShows the number of DC-to-DC binds per second that are serviced by this DC.
DRAInboundBytesTotalPersecDRAInboundBytesTotalPersecBytes per secondIt is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
DRAInboundObjectsAppliedPersecDRAInboundObjectsAppliedPersecNULLThis counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
ABClientSessionsABClientSessionsNULLAB Client Sessions is the number of connected Address Book client sessions.
LDAPClientSessionsLDAPClientSessionsNULLThe number of sessions of connected LDAP clients. Lack of activity points to network problems.
DSDirectoryReadsPersecDSDirectoryReadsPersecNULLShows the number of directory reads per second.
DRAPendingReplicationSynchronizationsDRAPendingReplicationSynchronizationsNULLThe number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
NTLMAuthenticationsNTLMAuthenticationsNULLThe number of NTLM authentications (per second) serviced by this domain controller
DSDirectoryWritesPersecDSDirectoryWritesPersecNULLShows the number of directory writes per second.
LDAPActiveThreadsLDAPActiveThreadsNULLLDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local direcotry service.
KerberosAuthenticationsKerberosAuthenticationsNULLThe number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
DRAOutboundBytesTotalPersecDRAOutboundBytesTotalPersecBytes per secondIt is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
LDAPWritesPersecLDAPWritesPersecNULLShows the rate at which LDAP clients perform write operations.
DSNotifyQueueSizeDSNotifyQueueSizeNULLThe number of pending update notifications that have been queued, but not yet transmitted to clients.
DSClientBindsPersecDSClientBindsPersecNULLShows the number of Ntdsapi.dll binds per second serviced by this DC.
LDAPUDPoperationsPersecLDAPUDPoperationsPersecNULLShows the number of UDP operations that the LDAP server is processing per second.
LDAPBindTimeLDAPBindTimeMillisecondsThis counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
LDAPSearchesPersecLDAPSearchesPersecNULLThe number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
DRAOutboundObjectsPersecDRAOutboundObjectsPersecNULLThe number of objects sent (per second) through outbound replication to replication partners.
DRAInboundObjectUpdatesRemaininginPacketDRAInboundObjectUpdatesRemaininginPacketNULLThis counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).

Agent G2 - AD Database Monitoring - v2

Description

Monitor AD database metrics like DBFileSizeGrowth, DBFile_DiskUsage, DiskHealthStatus, FreeDiskSpace.

Note: Previous version “Agent G2 - AD Database Monitoring” template has a bug at the monitor level. We recommend using the latest template (Agent G2 - AD Database Monitoring - v2)

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - AD Database Custom Monitor - v2AD_Database_DBFileSizeGrowthAD Database DBFile Size GrowthMBIt monitors the growth of the Active Directory database file size. It calculates the delta of the database file size from previous poll to current poll.
AD_Database_FreeDiskSpaceAD Database FreeDiskSpaceMBIt monitors the free disk space in MB for the drives which are having Active Directory Database file / Log file.
AD_Database_DiskHealthStatusAD Database Disk Health StatusnullIt monitors the disk health status of the drive which is having an Active Directory DB File. Below are the possible states: 0 - Healthy 1 - Warning 2 - Unhealthy 3 - Unknown
AD_Database_DBFile_DiskUsageAD Database DBFile DiskUsage%It monitors the disk usage% of the drive which is having Active Directory DB file.

Agent G2 - AD Performance Counters DotNet v4

Description

Agent G2 - AD Performance Counters DotNet v4

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - AD Performance Counters DotNet v4directory.services.ldap.successful.binds.per.secDirectory Services LDAPSuccessfulbindspersecNULLNumber of LDAP Binds per second
directory.services.dra.outbound.values.dns.only.per.secDirectory Services DRAOutboundvaluesdnsonlypersecNULLNumber of object property values containing Distinguished Names sent to outbound replication partners. DN-values, such as group or distribution list memberships, are generally more expensive to read than other kinds of values
directory.services.dra.inbound.values.dns.only.per.secDirectory Services DRAInboundvaluesdnsonlypersecNULLNumber of object property values received from inbound replication partners that are Distinguished Names; i.e., that reference other objects. DN-values, such as group or distribution list memberships, are generally more expensive to apply than other kind
directory.services.threads.in.useDirectory Services ThreadsinuseNULLDS Threads in Use is the current number of threads in use by the directory service (different than the number of threads in the directory service process). Threads in Use is the number of threads currently servicing client API calls and can be used to in
directory.services.dra.inbound.full.sync.objects.remainingDirectory Services DRAInboundfullsyncobjectsremainingNULLNumber of objects remaining until the full sync completes (when set)

Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4

Description

Template for Symantec backup exec. Monitors total bytes, total directories and total files. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4TotalDirectoriesTotalDirectoriesNULLThe total number of directories that have been backed up since the Backup Exec Engine Service last started.
TotalFilesTotalFilesNULLThe total number of files that have been backed up since the Backup Exec Engine Service last started.
TotalBytesTotalBytesNULLThe total number of bytes that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4

Description

12.5_Symantec_Backup_Exec. Monitors total bytes, total directories and total files.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4TotalBytesTotalBytesNULLThe total number of bytes that have been backed up since the Backup Exec Engine Service last started.
FailedJobsFailedJobsNULLThe number of jobs that have failed since the Backup Exec Engine Service last started.
TotalDirectoriesTotalDirectoriesNULLThe total number of directories that have been backed up since the Backup Exec Engine Service last started.
TotalFilesTotalFilesNULLThe total number of files that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4

Description

Monitors the AbortedJobs, ActiveJobCount, BackupDeviceWaitTime, InUseSkippedObjects MountTime, TotalExchangeMailboxes, TotalSQLServerDatabases.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4BackupDeviceWaitTimeBackupDeviceWaitTimeSecondsThe total time (in seconds) all backup jobs have spent waiting for a storage device since the Backup Exec Engine Service last started.
AbortedJobsAbortedJobsNULLThe number of jobs that have been aborted since the Backup Exec Engine Service last started.
MountTimeMountTimeSecondsThe total time (in seconds) all jobs have spent waiting for media to be mounted in a storage device since the Backup Exec Engine Service last started.
InUseSkippedObjectsInUseSkippedObjectsNULLThe number of objects that have been skipped because they were in use during backup since the Backup Exec Engine Service last started.
FailedJobsFailedJobsNULLThe number of jobs that have failed since the Backup Exec Engine Service last started.
ActiveJobCountActiveJobCountNULLThe number of jobs currently active (running or pending) in the Backup Exec Engine Service.

Agent G2 - Blackberry 501 Performance Counters DotNet v4

Description

Monitor Blackberry 501 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Blackberry 501 Performance Counters DotNet v4MessagesQueuedForDeliveryMessagesQueuedForDeliveryNULLBlackberry Agent displays queued messages for delivery
MessagesExpiredMessagesExpiredNULLBlackberry Agent displays expired messages
MessagesSentMessagesSentNULLBlackberry Agent displays sent messages
MessagesReceivedMessagesReceivedNULLBlackberry Agent displays received messages
MessagesFilteredMessagesFilteredNULLBlackberry Agent displays filtered messages

Agent G2 - Blackberry Enterprise Server

Description

Template for BlackBerry enterprise server. Monitors messages expired, messages filtered, messages queued for delivery, messages received and messages sent. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Blackberry Enterprise ServerMessagesQueuedForDeliveryMessagesQueuedForDeliveryNULLBlackberry Agent displays queued messages for delivery
MessagesExpiredMessagesExpiredNULLBlackberry Agent displays expired messages
MessagesSentMessagesSentNULLBlackberry Agent displays sent messages
MessagesReceivedMessagesReceivedNULLBlackberry Agent displays received messages
MessagesFilteredMessagesFilteredNULLBlackberry Agent displays filtered messages

Agent G2 - Blackberry Performance Counters DotNet v4

Description

Monitors Blackberry Performance Counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Blackberry Performance Counters DotNet v4MessagesQueuedForDeliveryMessagesQueuedForDeliveryNULLBlackberry Agent displays queued messages for delivery
MessagesExpiredMessagesExpiredNULLBlackberry Agent displays expired messages
MessagesSentMessagesSentNULLBlackberry Agent displays sent messages
MessagesReceivedMessagesReceivedNULLBlackberry Agent displays received messages
MessagesFilteredMessagesFilteredNULLBlackberry Agent displays filtered messages

Agent G2 - Cisco Unity Performance Counters DotNet v4

Description

Monitors Cisco Unity Performance data

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Cisco Unity Performance Counters DotNet v4IncomingCallsExternalCurrentIncomingCallsExternalCurrentNULLThe current number of incoming calls from external callers.
PortsIdleCurrentPortsIdleCurrentNULLThe current number of integration ports that are not in use by the Cisco Unity Connection server.
TTSSessionsPersecTTSSessionsPersecNULLThe number of active TTS voice sessions per second.
MessageStoresOfflineCurrentMessageStoresOfflineCurrentNULLA current total of Cisco Unity Message Stores that are offline.
PortsUsedCurrentPortsUsedCurrentNULLThe current number of integration ports that are in use by the Cisco Unity Connection server.
AverageAuthenticationTimeAverageAuthenticationTimeNULLAverage time taken to authenticate.
TTSSessionDurationAverageTTSSessionDurationAverageNULLThe average duration of all TTS sessions in seconds.
MessageStoresOnlineCurrentMessageStoresOnlineCurrentNULLA current total of Cisco Unity Message Stores that are online.
PortsLockedCountPortsLockedCountNULLThe current count of the ports that no longer respond or are otherwise unusable by Cisco Unity Connection
UnityMTAMessageCountCurrentUnityMTAMessageCountCurrentNULLThe number of messages currently queued in the MTA(Message Transfer Agent).
IncomingCallsDurationAverageIncomingCallsDurationAverageNULLThe average duration in seconds of all incoming calls to the Cisco Unity Connection server.
DirectoryResynchronizationDurationAverageDirectoryResynchronizationDurationAverageNULLThe average duration of information directory synchronization, in seconds
PortsIdleDurationAveragePortsIdleDurationAverageNULLThe average time that any port remains idle between incoming calls to the Cisco Unity Connection server in seconds.
OutgoingCallsDurationAverageOutgoingCallsDurationAverageNULLThe average duration of all outgoing calls from the Cisco Unity Connection server in seconds.

Agent G2 - Citrix Broker Agent DotNet v4

Description

Monitors Citrix Broker Agent role performance Counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix Broker Agent DotNet v4citrix.broker.agent.total.sessionsCitrixBrokerAgent TotalSessionsNULLTotal Number of Sessions
citrix.broker.agent.num.of.registrationsCitrixBrokerAgent NumberofRegistrationsNULLTotal Number of Registrations
citrix.broker.agent.total.app.sessionsCitrixBrokerAgent TotalAppSessionsNULLTotal Number of Seamless App Sessions
citrix.broker.agent.total.notificationsCitrixBrokerAgent TotalNotificationsNULLTotal Number of Notifications
citrix.broker.agent.num.of.deregistrationsCitrixBrokerAgent NumberofDeregistrationsNULLTotal Number of DeRegistrations
citrix.broker.agent.total.desktops.sessionCitrixBrokerAgent TotalDesktopsSessionNULLTotal Number of Desktop Sessions

Agent G2 - Citrix Broker Service DotNet v4

Description

Monitors Citrix Broker Service role performance counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix Broker Service DotNet v4citrix.broker.service.hard.registrations.per.secCitrixBrokerService HardRegistrationsPerSecNULLHard Registrations/sec is the rate at which virtual desktop agents hard-register with Citrix Broker Service

Agent G2 - Citrix Licensing

Description

Template for Citrix Licensing

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix LicensingTotal_LicenseTotal_LicenseNULLThe sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
License_UsageLicense_UsageNULLThe sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
License_Used_PercentageLicense_Used_PercentageNULLLicense percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
License_SA_Expiry_in_daysLicense_SA_Expiry_in_daysNULLProvides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Licensing Performance Counters

Description

Monitors Citrix Licensing Performance data

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix Licensing Performance CountersTotal_LicenseTotal_LicenseNULLThe sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
License_UsageLicense_UsageNULLThe sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
License_Used_PercentageLicense_Used_PercentageNULLLicense percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
License_SA_Expiry_in_daysLicense_SA_Expiry_in_daysNULLProvides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Performance Counters DotNet v4

Description

These performance counters should be used to monitor the key performance metrics of the Citrix infrastructure, application servers, and virtual desktops.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix Performance Counters DotNet v4citrix.percent.processor.timeCitrix Percent Processor Time%Percent Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the duration of the idle thread is active in the sample interval, and subtracting that time from interval duration. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It is calculated by monitoring the time that the service is inactive and subtracting that value from 100 Percent
citrix.logicaldisk.avg.disksecpertransferCitrix LogicalDisk Avg DiskSecPerTransferMSThe Average Disk Second counters show the average time in seconds of a transfer from or to a disk.
citrix.logicaldisk.currentdiskqueuelengthCitrix LogicalDisk CurrentDiskQueueLengthNULLCurrent disk queue length provides a primary measure of disk congestion. It is an indication of the number of transactions that are waiting to be processed.
citrix.logicaldisk.avg.disksecperwriteCitrix LogicalDisk Avg DiskSecPerWriteMSThe Average Disk Second counters show the average time in seconds of a write from or to a disk.
citrix.logicaldisk.percent.disktimeCitrix LogicalDisk Percent DiskTime%Percent Disk Time marks how busy the disk is.
citrix.network.interface.bytestotalpersecCitrix Network Interface BytesTotalPerSecNULLBytes Total/sec shows the rate at which the network adaptor is processing data bytes. This counter includes all application and file data, in addition to protocol information, such as packet headers.
citrix.system.processor.queuelengthCitirx System Processor Queue LengthNULLProcessor queue length is the number of threads in the processor queue. Unlike the disk counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than ten threads per processor is normally acceptable, dependent of the workload.
citrix.paging.file.percentusageCitrix Paging File Percent UsageNULLThis is the percentage amount of the Page File instance in use.
citrix.logicaldisk.percent.freespaceCitrix LogicalDisk Percent FreeSpace%Percent Free Space is the percentage of total usable space on the selected logical disk drive that is free.
citrix.memory.available.bytesCitrix Memory Available Bytes%Available memory indicates the amount of memory that is left after nonpaged pool allocations, paged pool allocations, process working sets, and the file system cache have all taken their piece.
citrix.logicaldisk.avg.disksecperreadCitrix LogicalDisk Avg DiskSecPerReadMSThe Average Disk Second counters show the average time in seconds of a read from or to a disk.

Agent G2 - Citrix XenApp 7.5 DotNet v4

Description

Monitor Citrix XenApp Server 7.5 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenApp 7.5 DotNet v4Citrix_Conf_Logging_Database_StateCitrix_Conf_Logging_Database_StateNULLDatabase Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected).

Agent G2 - Citrix XenApp 7.6 DotNet v4

Description

Monitor Citrix XenApp Server 7.6 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenApp 7.6 DotNet v4citrix.conf.loggingdatabase.avgtransactiontimeCitirx Conf Logging Database Avg Transaction TimeNULLThe time on average, in seconds, taken to execute a database transaction. A baseline needs to be established in the environment in order to accurately establish threshold values.
citrix.monitor.database.connectedCitrix Monitor Database ConnectedNULLDatabase Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)
citrix.conf.loggingdatabase.transactionerrorspersecCitrix Conf Logging Database Transaction Errors Per secNULLThe rate at which database transactions are failing.
citrix.env.test.database.connectedCitrix Env Test Database ConnectedNULLDatabase Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)

Agent G2 - Citrix XenApp Advanced Performance Check

Description

XenApp Advanced Monitoring

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenApp Advanced Performance CheckXADisconnectedSessionsXADisconnectedSessionsCountLists sessions in disconnected state. This helps identify if there are any sporadic disconnects from the server.
XAOfflineServersXAOfflineServersCountA server can be taken offline either for maintenance or because the Server is unstable and is removed from available servers. These servers will not service any user requests.
XAServerLoadXAServerLoadNULLThis monitor displays the load on each Citrix XenApp Servers. These load values can identify issues with your servers in addition to determining which server is the least/most loaded in your farm. A trending value of this monitor helps identify peak usage of the servers. A value greater than 9000 indicates a heavily loaded server
XAServerApplicationXAServerApplicationCountNumber of applications hosted on each server. This help you decide if the load is distributed evenly across all your servers.
XASessionsXASessionsCountNumber of active sessions per server.

Agent G2 - Citrix XenApp Performance Check DotNet v4

Description

XenApp Standard Monitoring

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenApp Performance Check DotNet v4LicenseServerConnectionFailureLicenseServerConnectionFailureNULLThe number of minutes that the XenApp server has been disconnected from the License Server. The time returned should be less than 30 minutes. Ideally the returned time should be zero.
WorkItemQueueExecutingCountWorkItemQueueExecutingCountNULLThe number of work items that are ready to be executed.
DataStorewritesPersecDataStorewritesPersecNULLThe number of times data was written to the data store per second.
ZoneElectionsTriggeredZoneElectionsTriggeredNULLThe number of times a server triggers a zone election.
STATicketTimeoutCountSTATicketTimeoutCountNULLThe total number of ticket time-outs that occur during the lifetime of the STA.
AverageLicenseCheckInResponseTimemsAverageLicenseCheckInResponseTimemsNULLThis component monitor returns the average response time for a license check-in operation in milliseconds.
LatencySessionDeviationLatencySessionDeviationNULLThis component monitor returns the difference between the minimum and the maximum session latency values. This value should be as low as possible.
BytesReceivedPersecBytes Received Per secNULLThis component monitor returns the data rate of incoming Independent Management Architecture(IMA) network traffic.
NetworkConnectionsNetworkConnectionsNULLThis component monitor returns the number of active network IMA connections to IMA servers.
LocalHostCachewritesPersecLocalHostCachewritesPersecNULLThe number of times data was written to the IMA local host cache per second.
ResolutionWorkItemQueueExecutingCountResolutionWorkItemQueueExecutingCountNULLThe number of work items that are currently being executed.
WorkItemQueuePendingCountWorkItemQueuePendingCountNULLThe number of work items that are not yet ready to be executed.
NumberofbusyXMLthreadsNumberofbusyXMLthreadsNULLThe number of busy threads.
DataStorereadsPersecDataStorereadsPersecNULLThe number of times data was read from the data store per second.
CPUEntitlementCPUEntitlementNULLThe percentage of CPU resource that Citrix CPU Utilization Management makes available to a user at a given time.
CPUUsageCPUUsageNULLThe percentage of CPU resource consumed by a user at a given time averaged over a few seconds.
STAPeakTicketRequestRateSTAPeakTicketRequestRateNULLThe maximum rate of ticket generation requests per second during the lifetime of the STA.
LongtermCPUUsageLongtermCPUUsageNULLThe percentage of CPU resource consumed by a user averaged over a longer period than the CPU Usage counter.
ApplicationResolutionsPersecApplicationResolutionsPersecNULLThe number of resolutions completed per second.
DynamicStorewritesPersecDynamicStorewritesPersecNULLThe number of times data was written to the dynamic store per second.
ApplicationEnumerationsPersecApplicationEnumerationsPersecNULLEnumeration is the process in which a client transmits data to locate servers on the network and retrieves information about the server farms published applications. During enumeration the XenApp Plug-in for Hosted Apps communicates with the Citrix XML Service or the ICA browser depending on the browsing protocol selected in the plug-in. This monitor provides the number of application enumerations per second.
DataStoreConnectionFailureDataStoreConnectionFailureNULLThe number of minutes that the XenApp server has been disconnected from the data store. This value should be zero at all times.
LastRecordedLicenseCheckOutResponseTimemsLastRecordedLicenseCheckOutResponseTimemsNULLThe last recorded license check-out response time in milliseconds.
WorkItemQueueReadyCountWorkItemQueueReadyCountNULLThe number of work items that are not yet ready to be executed.
STAPeakAllRequestRateSTAPeakAllRequestRateNULLSecure Ticket Authority (STA) is responsible for issuing session tickets in response to connection requests for published resources on XenApp. These session tickets form the basis of authentication and authorization for access to published resources.
LatencySessionAverageLatencySessionAverageNULLThe average client latency over the lifetime of a session.
LatencyLastRecordedLatencyLastRecordedNULLThis component monitor returns the last recorded latency value of the session.
ICARoundtripLatencyMedianICARoundtripLatencyMedianNULLThe median time of ICA roundtrip latency for all sessions on the server.
BytesSentPersecBytesSentPersecNULLThis component monitor returns the data rate of outgoing IMA network traffic.
STAPeakTicketRefreshRateSTAPeakTicketRefreshRateNULLThe maximum rate of refresh requests per second during the lifetime of the STA.
ResolutionWorkItemQueueReadyCountResolutionWorkItemQueueReadyCountNULLThe number of work items that are ready to be executed.
CPUReservationCPUReservationNULLThe percentage of total computer CPU resource reserved for a user, should that user require it.
CPUSharesCPUSharesNULLThe proportion of CPU resource assigned to a user.
LocalHostCachereadsPersecLocalHostCachereadsPersecNULLThe number of times data was read from the IMA local host cache per second.
MaximumnumberofXMLthreadsMaximumnumberofXMLthreadsNULLThe maximum number of threads allocated to service Web-based sessions since the server restarted.
AverageLicenseCheckOutResponseTimemsAverageLicenseCheckOutResponseTimemsNULLThis component monitor returns the average response time for a license check-out operation in milliseconds.
ApplicationResolutionsFailedPersecApplicationResolutionsFailedPersecNULLThe number of application resolutions failed per second.
DynamicStorereadsPersecDynamicStorereadsPersecNULLThe number of times data was read from the dynamic store per second.
STAPeakDataRequestRateSTAPeakDataRequestRateNULLThe maximum rate of data requests per second during the lifetime of the STA.
ZoneElectionsWonZoneElectionsWonNULLThe number of times a server wins a zone election.
ApplicationResolutionTimemsApplicationResolutionTimemsmsThe time in milliseconds that a resolution took to complete. A baseline would be needed in order to establish increases during peak logon times before an accurate threshold can be defined.

Agent G2 - Citrix XenDesktop Advanced Performance Check

Description

Citrix XenDesktop advanced monitoring based on performance counters.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenDesktop Advanced Performance CheckDesktopsWithRegistrationStateAsAgentErrorDesktopsWithRegistrationStateAsAgentErrorNULLLists all Virtual Desktops which have not registered with the controller due to Agent Error. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
DesktopsUnRegisteredDesktopsUnRegisteredNULLLists all Virtual Desktops in the Unregistered state. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
DesktopsWithUnknownPowerStateDesktopsWithUnknownPowerStateNULLThe Virtual desktop power state and issuing of power commands to the VM depends on the DDC services being able to communicate with the hypervisor that hosts the VM. The unknown power state is a result of the DDC never having received a notification of the power state of the VM from the hypervisor (hence state unknown).
DesktopsNeverRegisteredDesktopsNeverRegisteredNULLVirtual desktop machine which never registered with the Desktop Controllers. An unregistered desktop cannot be used by an end-user.
TotalDesktopsTotalDesktopsNULLThe total number of desktops in a given Desktop Group.
BrokerHypervisorAlertSeverityRedBrokerHypervisorAlertSeverityRedNULLLists the current alerts objects reported by the hypervisors that the controller is monitoring.
DesktopsFacingICALatencyDesktopsFacingICALatencyNULLDesktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). High latency on this communication channel would result in slowness/freezing of sessions.
DesktopsDisconnectedDesktopsDisconnectedNULLNumber of Virtual Desktops whose summary state is in disconnected state.
DesktopsFacingHighProfileLoadTimeDesktopsFacingHighProfileLoadTimeNULLDesktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). Profile Load time is directly impacted with the profile size. This results in users experiencing logon delays.
DesktopsAvailableDesktopsAvailableNULLThe number of desktops available in a desktop group.
DesktopGroupsUsageDesktopGroupsUsageNULL% of virtual desktop machines used within a group.
DesktopsInUseDesktopsInUseNULLThe number of desktops currently in use in a given Desktop Group.
ActiveSessionsActiveSessionsNULLThe number of Desktop sessions currently streamed.
DesktopsinMaintenanceModeDesktopsinMaintenanceModeNULLPutting a desktop in maintenance mode temporarily stops connections to the desktop so that maintenance tasks can be carried out. A user trying to connect to a desktop in maintenance mode will receive a message telling them the desktop is currently unavailable and to try reconnecting. XenDesktop has no control over desktops in maintenance mode. No user can log on to a desktop in this state. If a user is already logged on, maintenance mode takes effect as soon as they log off.
DesktopsWithImageOutOfDateDesktopsWithImageOutOfDateNULLShows Desktop Groups that have desktops with Out Of Date Images

Agent G2 - Citrix XenDesktop Performance Counters

Description

Monitors the XenDesktop System, Power status, Available system count, Delivery Group Desktops available count, unregistered count along with the Controller details like State, Services 7 Licensing details etc., Applicable on the XenApp/Xendesktop 7.x versions.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenDesktop Performance Countersbroker.desktop.group.desktops.availableBrokerDesktopGroup DesktopsAvailable%Number of available desktops
broker.desktop.group.desktops.disconnectedBrokerDesktopGroup DesktopsDisconnected%Number of disconnected desktops
broker.catalog.available.countBrokerCatalog AvailableCountNULLNumber of available systems
broker.desktop.group.desktops.unregisteredBrokerDesktopGroup DesktopsUnregistered%Number of unregistered desktops
broker.desktop.group.desktops.never.registeredBrokerDesktopGroup Desktops NeverRegistered%Number of desktops never registered
broker.desktop.group.desktops.preparingBrokerDesktopGroup DesktopsPreparing%Number of desktops in preparing state

Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4

Description

Applicable on XenDesktop - Desktop Delivery Controller

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4RegistrationRequestsPersecRegistrationRequestsPersecNULLRegistration Requests/sec is the rate at which Citrix Broker Service receives registration requests from virtual desktops.
RegistrationAvgRequestTimeRegistrationAvgRequestTimeNULLRegistration Avg. Request Time is the time on average in seconds taken to process a virtual desktop registration request in Citrix Broker Service. This delay is a one time daily expense
BrokeredSessionsBrokeredSessionsNULLBrokered Sessions is the number of virtual desktop sessions brokered by the Citrix Broker Service.

Agent G2 - CPU - Run Queue Monitor DotNet v4

Description

Number of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - CPU - Run Queue Monitor DotNet v4cpu.run.queue.monitorCPU Run Queue MonitorNULLNumber of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Agent G2 - DB-Oracle DotNet v4

Description

Monitors Oracle Performance Counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - DB-Oracle DotNet v4Oracle_UserRollbacksOracle User RollbacksCountValidates the Number of User Roll backs.
Oracle_DataFileDiskWritesOracle Data File Disk WritesCountValidates the Number of Data file disk writes to database.
Oracle_CacheInvalidationsOracle Cache InvalidationsCountValidates the how many Cache invalidations on particular database.
Oracle_TableSpaceFreeOracle Table Space FreeMBValidates free table space available
Oracle_UsersCommitOracle Users CommitCountValidates Number of User commits
Oracle_TableSpaceAllocatedOracle Table Space AllocatedMBValidates the Size allocated for the table by database.
Oracle_SessionsOracle SessionsCountValidates how many sessions currently on particular database.
Oracle_DataFileDiskReadsOracle Data File Disk ReadsCountValidates the Number of Data file disk reads by database.
Oracle_LibraryCacheReloadsOracle Library Cache ReloadsCountValidates the Number of Library Cache Reloads by database.
Oracle_DataFilelesizeAllocatedOracle Data File size AllocatedMBValidates the Data File Size Allocated for the database.
Oracle_LibraryCacheGetsOracle Library Cache GetsCountValidates the Number of Library Cache gets by database.
Oracle_LongRunningQueriesOracle Long Running QueriesCountValidates the how many long running queries on particular database.
Oracle_TablescanBlocksOracle Table scan BlocksCountValidates the Number of Table scan blocks by database.
Oracle_BlockingLockQueriesOracle Blocking Lock QueriesCountValidates the how many block lock queries on particular database.
oracle_processesOracle ProcessesCountValidates the how many processes on particular database.

Agent G2 - Dell Hardware Health - WMI DotNet v4

Description

Monitors the Dell hardware health parameters like CPU Status, Memory status, Fan status, Fan reading, Temperature status, Temperature reading, Power consumption watts sensor status, Power consumption watts sensor reading, Power consumption amps sensor status, Power consumption amps sensor reading, voltage status and voltage reading.

Prerequisites

Validated on Dell PowerEdge R710, Microsoft Windows Server 2008 R2 Standard Edition Service Pack 1, 64-bit.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Dell Hardware Health - WMI DotNet v4dell.voltage.sensor.readingVoltage ReadingNULLDell Voltage sensor current reading in millivolts.
dell.temperature.readingTemperature ReadingNULLDell Temperature sensor current reading in centigrade.
dell.power.consumption.ampssensor.readingPower Consumption Amps Sensor ReadingNULLDell Power consumption amps sensor current reading.

Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4

Description

DFS Monitoring - Namespace and Replication Check

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4dfsnamespaceserviceapirequests.requestsprocessedDFSNamespaceServiceAPIRequests RequestsProcessedNULLRequests Processed shows the number of requests to one API that were processed by the DFS Namespace service.
dfsreplicatedfolders.deletedspaceinuseDFSReplicatedFolders DeletedSpaceInUseNULLDeleted Space in Use shows the total size (in bytes) of the deleted files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service detects remote deletes from its sending partner and moves the file or folder to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.deletedfilesgeneratedDFSReplicatedFolders DeletedFilesGeneratedNULLDeleted Files Generated shows the number of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationconnections.totalfilesreceivedDFSReplicationConnections TotalFilesReceivedNULLTotal Files Received shows the number of files that were received on the connection.
dfsreplicatedfolders.conflictfoldercleanupscompletedDFSReplicatedFolders ConflictFolderCleanupsCompletedNULLConflict Folder Cleanups Completed shows the number of times conflict loser files and folders in the Conflict and Deleted folder were deleted by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationconnections.rdcbytesreceivedDFSReplicationConnections RDCBytesReceivedNULLRDC Bytes Received shows the bytes that were received on this connection while replicating files using remote differential compression (RDC). This is the actual bytes received over the network without the networking protocol overhead.
dfsreplicatedfolders.stagingspaceinuseDFSReplicatedFolders StagingSpaceInUseNULLStaging Space In Use shows the total size (in bytes) of the files and folders currently in the staging folder used by the DFS Replication service. This counter will fluctuate as staging space is reclaimed. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationconnections.sizeoffilesreceivedDFSReplicationConnections SizeofFilesReceivedNULLSize of Files Received shows the uncompressed size (in bytes) of the files received on this connection. This is the number of bytes that would have been received had DFS Replication compression not been used.
dfsnamespaceservicereferrals.requestsprocessedpersecDFSNamespaceServiceReferrals RequestsProcessedPersecNULLRequests Per Sec. shows the number of referral requests per second that were processed by the DFS Namespace service.
dfsreplicationservicevolumes.usnjournalrecordsreadDFSReplicationServiceVolumes USNJournalRecordsReadNULLUSN Journal Records Read shows the number of update sequence number (USN) journal records that were read by the DFS Replication service.
dfsreplicatedfolders.deletedbytesgeneratedDFSReplicatedFolders DeletedBytesGeneratedNULLDeleted Bytes Generated shows the total size (in bytes) of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.stagingfilescleanedupDFSReplicatedFolders StagingFilesCleanedupNULLStaging Files Cleaned up shows the number of files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationconnections.rdcsizeoffilesreceivedDFSReplicationConnections RDCSizeofFilesReceivedNULLRDC Size of Files Received shows the uncompressed size (in bytes) of files received with remote differential compression (RDC) for this connection. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual number of bytes received over the network.
dfsreplicatedfolders.conflictspaceinuseDFSReplicatedFolders ConflictSpaceInUseNULLConflict Space in Use shows the total size (in bytes) of the conflict loser files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.rdcbytesreceivedDFSReplicatedFolders RDCBytesReceivedNULLRDC Bytes Received shows the number of bytes that were received in replicating files using remote differential compression (RDC) for this replicated folder. This is the actual bytes received over the network without the networking protocol overhead.
dfsreplicationconnections.compressedsizeoffilesreceivedDFSReplicationConnections CompressedSizeofFilesReceivedNULLCompressed Size of Files Received shows the compressed size of files (in bytes) received on the connection.
dfsreplicatedfolders.conflictbytesgeneratedDFSReplicatedFolders ConflictBytesGeneratedNULLConflict Bytes Generated shows the total size (in bytes) of the files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.rdcnumberoffilesreceivedDFSReplicatedFolders RDCNumberofFilesReceivedNULLRDC Number of Files Received shows the number files that were received for this replicated folder.
dfsreplicatedfolders.conflictfilescleanedupDFSReplicatedFolders ConflictFilesCleanedupNULLConflict Files Cleaned up shows the number the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.fileinstallssucceededDFSReplicatedFolders FileInstallsSucceededNULLFile Installs Succeeded shows the number of files that were successfully received from sending members and installed locally on this server. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
dfsreplicatedfolders.conflictbytescleanedupDFSReplicatedFolders ConflictBytesCleanedupNULLConflict Bytes Cleaned up shows the total size (in bytes) of the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.stagingbytescleanedupDFSReplicatedFolders StagingBytesCleanedupNULLStaging Bytes Cleaned up shows the total size (in bytes) of the files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationservicevolumes.databasecommitsDFSReplicationServiceVolumes DatabaseCommitsNULLDatabase Commits shows the number of database commit operations performed by the DFS Replication service. This counter indicates how intensive the DFS Replication service is from a database perspective.
dfsreplicatedfolders.fileinstallsretriedDFSReplicatedFolders FileInstallsRetriedNULLFile Installs Retried shows the number of file installs that are being retried due to sharing violations or other errors encountered when installing the files. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
dfsreplicatedfolders.stagingfilesgeneratedDFSReplicatedFolders StagingFilesGeneratedNULLStaging Files Generated shows the number of times replicated files and folders were staged by the DFS Replication service. The DFS Replication service stages files and folders in a staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.totalfilesreceivedDFSReplicatedFolders TotalFilesReceivedNULLTotal Files Received shows the number of files that were received by this replicated folder.
dfsnamespaceservicereferrals.requestsprocessedDFSNamespaceServiceReferrals RequestsProcessedNULLRequests Processed shows the number of referral requests that were processed by the DFS Namespace service.
dfsreplicatedfolders.deletedbytescleanedupDFSReplicatedFolders DeletedBytesCleanedupNULLDeleted Bytes Cleaned up shows the total size (in bytes) of replicating deleted files and folders (in bytes) that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicatedfolders.rdccompressedsizeoffilesreceivedDFSReplicatedFolders RDCCompressedSizeofFilesReceivedNULLRDC Compressed Size of Files Received shows the compressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had RDC not been used. This is not the actual bytes received over the network.
dfsreplicationconnections.bytesreceivedpersecondDFSReplicationConnections BytesReceivedPerSecondNULLBytes Received Per Second shows an estimate of the average number of bytes that were received each second over the past 30 seconds.
dfsreplicationservicevolumes.usnjournalunreadpercentageDFSReplicationServiceVolumes USNJournalUnreadPercentageNULLUSN Journal Unread Percentage shows the percent of the update sequence number (USN) journal that has not yet been read and processed by the DFS Replication service. A journal wrap will occur if this counter reaches 100.
dfsreplicatedfolders.compressedsizeoffilesreceivedDFSReplicatedFolders CompressedSizeofFilesReceivedNULLCompressed Size of Files Received shows the compressed size of files (in bytes) received for this replicated folder.
dfsreplicatedfolders.deletedfilescleanedupDFSReplicatedFolders DeletedFilesCleanedupNULLDeleted Files Cleaned up shows the number of replicated deleted files and folders that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsnamespaceservicereferrals.requestsfailedDFSNamespaceServiceReferrals RequestsFailedNULLRequests Failed shows the number of referral requests that were failed by the DFS Namespace service.
dfsreplicatedfolders.updatesdroppedDFSReplicatedFolders UpdatesDroppedNULLUpdates Dropped shows the number of redundant file replication update records that were ignored by the DFS Replication service because they did not change the replicated file or folder. For example, dropped updates can occur when access control lists (ACLs) are overwritten with identical ACLs on a file or folder.
dfsreplicationconnections.rdccompressedsizeoffilesreceivedDFSReplicationConnections RDCCompressedSizeofFilesReceivedNULLCompressed Size of Files Received shows the compressed size (in bytes) of files received for this replicated folder.
dfsnamespaceserviceapirequests.requestsfailedDFSNamespaceServiceAPIRequests RequestsFailedNULLRequests Failed shows the number of requests to one API that were failed by the DFS Namespace service.
dfsreplicatedfolders.bandwidthsavingsusingdfsreplicationDFSReplicatedFolders BandwidthSavingsUsingDFSReplicationNULLBandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this replicated folder using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
dfsnamespaceservicereferrals.avgresponsetimeDFSNamespaceServiceReferrals AvgResponseTimeNULLAvg Response Time shows the average response time to the referral requests that were processed by the DFS Namespace service.
dfsreplicationconnections.rdcnumberoffilesreceivedDFSReplicationConnections RDCNumberofFilesReceivedNULLRDC Number of Files Received shows the number files that were received on this connection.
dfsreplicationconnections.bandwidthsavingsusingdfsreplicationDFSReplicationServiceVolumes BandwidthSavingsUsingDFSReplicationNULLBandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this connection using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth use. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
dfsnamespaceserviceapirequests.requestsprocessedpersecDFSNamespaceServiceAPIRequests RequestsProcessedPersecNULLRequests Per Sec. Rate shows the number of API requests per second that were processed by the DFS Namespace service.
dfsreplicationconnections.totalbytesreceivedDFSReplicationConnections TotalBytesReceivedNULLTotal Bytes Received shows the total number of bytes received on the connection. The bytes received value includes file data and replication metadata.
dfsreplicatedfolders.conflictfilesgeneratedDFSReplicatedFolders ConflictFilesGeneratedNULLConflict Files Generated shows the number of files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
dfsreplicationservicevolumes.usnjournalrecordsacceptedDFSReplicationServiceVolumes USNJournalRecordsAcceptedNULLUSN Journal Records Accepted shows the number of update sequence number (USN) journal records that were processed by the DFS Replication service. The DFS Replication service processes all USN journal records for replicated content on a volume and ignores records for non-replicated files and folders on the volume.
dfsnamespaceserviceapirequests.avgresponsetimeDFSNamespaceServiceAPIRequests AvgResponseTimeNULLAvg Response Time shows the average response time to the requests to one API that were processed by the DFS Namespace service.
dfsnamespace.foldercountDFSNamespace FolderCountNULLFolder count shows the number of DFS folders or links in a namespace.
dfsreplicatedfolders.sizeoffilesreceivedDFSReplicatedFolders SizeofFilesReceivedNULLSize of Files Received shows the uncompressed size (in bytes) of the files received for this replicated folder. This is the number of bytes that would have been received had DFS Replication compression not been used.
dfsreplicatedfolders.rdcsizeoffilesreceivedDFSReplicatedFolders RDCSizeofFilesReceivedNULLRDC Size of Files Received shows the uncompressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual bytes received over the network.
dfsreplicationservicevolumes.databaselookupsDFSReplicationServiceVolumes DatabaseLookupsNULLDatabase Lookups shows the number of database search operations performed by the DFS Replication service This counter indicates how intensive the DFS Replication service is from a database perspective.
dfsreplicatedfolders.stagingbytesgeneratedDFSReplicatedFolders StagingBytesGeneratedNULLStaging Bytes Generated shows the total size (in bytes) of replicated files and folders in the staging folder created by the DFS Replication service since last restart and is monotonically increasing counter. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.

Agent G2 - Disk Performance Monitoring DotNet v4

Description

Disk Performance Monitoring

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Disk Performance Monitoring DotNet v4AverageDiskWriteQueueLengthAverageDiskWriteQueueLengthNULLAvg. Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval.
AvgDisksecPerReadAvgDisksecPerReadNULLAvg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
PercentDiskTimePercentDiskTimeNULL% Disk Time is the percentage of elapsed time that the selected disk drive was busy servicing read or write requests.
AverageDiskReadQueueLengthAverageDiskReadQueueLengthNULLAvg. Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval.
AvgDisksecPerWriteAvgDisksecPerWriteNULLAvg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
AvgDiskBytesPerTransferAvgDiskBytesPerTransferNULLAvg. Disk Bytes/Transfer is the average number of bytes transferred to or from the disk during write or read operations. The disk is efficient if it transfers large amounts of data relatively quickly.
AverageDiskQueueLengthAverageDiskQueueLengthNULLAvg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.

Agent G2 - DNS Performance Counters DotNet v4

Description

Monitors DNS performance counters

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - DNS Performance Counters DotNet v4dns.dynamic.update.requests.receivedDNS DynamicUpdateRequestsReceivedNULLDynamic Update Received is the total number of dynamic update requests received by the DNS server.
dns.total.queries.received.per.secDNS TotalQueriesReceivedPerSecNULLTotal Query Received/sec is the average number of queries received by DNS server in each second.
dns.dynamic.update.requests.empty.persecDNS DynamicUpdateRequestsEmptyPerSecNULLDynamic Update NoOperation/sec is the average number of No-operation/Empty dynamic update requests received by the DNS server in each second.
dns.nb.stat.memory.usedDNS NbStatMemoryUsedNULLNbstat Memory is the total Nbstat memory used by DNS server.
dns.udp.queries.received.per.secDNS UDPQueriesReceivedPerSecNULLUDP Query Received/sec is the average number of UDP queries received by DNS server in each second.
dns.zone.transfers.successDNS ZoneTransfersSuccessNULLZone Transfer Success is the total number of successful zone transfers of the master DNS server.
dns.tcp.queries.received.per.secDNS TCPQueriesReceivedPerSecNULLTCP Query Received/sec is the average number of TCP queries received by DNS server in each second.
dns.caching.memory.usedDNS CachingMemoryUsedNULLCaching Memory is the total caching memory used by DNS server.
dns.secure.updates.failedDNS SecureUpdatesFailedNULLSecure Update Failure is the total number of secure updates failed of the DNS server.
dns.tcp.message.memory.usedDNS TCPMessageMemoryUsedNULLTCP Message Memory is the total TCP message memory used by DNS server.
dns.database.node.memory.usedDNS DatabaseNodeMemoryUsedNULLDatabase Node Memory is the total database node memory used by DNS server.
dns.dynamic.update.requests.rejectedDNS DynamicUpdateRequestsRejectedNULLDynamic Update Rejected is the total number of dynamic updates rejected by the DNS server.
dns.dynamic.updates.written.to.databaseDNS DynamicUpdateswrittentodatabaseNULLDynamic Update Written to Database is the total number of dynamic updates written to the database by the DNS server.
dns.secure.update.requests.receivedDNS SecureUpdateRequestsReceivedNULLSecure Update Received is the total number of secure update requests received by the DNS server.
dns.udp.responses.sent.per.secDNS UDPResponsesSentPerSecNULLUDP Response Sent/sec is the average number of UDP reponses sent by DNS server in each second.
dns.udp.message.memory.usedDNS UDPMessageMemoryUsedNULLUDP Message Memory is the total UDP message memory used by DNS server.
dns.record.flow.memory.usedDNS RecordFlowMemoryUsedNULLRecord Flow Memory is the total record flow memory used by DNS server.
dns.tcp.responses.sent.per.secDNS TCPResponsesSentPerSecNULLTCP Response Sent/sec is the average number of TCP reponses sent by DNS server in each second.
dns.zone.transfers.failedDNS ZoneTransfersFailedNULLZone Transfer Failure is the total number of failed zone transfers of the master DNS server.
dns.total.responses.sent.per.secDNS TotalResponsesSentPerSecNULLTotal Response Sent/sec is the average number of reponses sent by DNS server in each second.
dns.dynamic.update.timeoutsDNS DynamicUpdateTimeoutsNULLDynamic Update TimeOuts is the total number of dynamic update timeouts of the DNS server.

Agent G2 - DNS Recursive Performance Counters DotNet v4

Description

Monitors DNS Recursive Class WMI Performance data

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - DNS Recursive Performance Counters DotNet v4DNS_RecursiveTimeOutPerSecDNS_RecursiveTimeOutPerSecNULLProvides the average number of recursive query sending timeouts in each second.
DNS_RecursiveQueryFailurePerSecDNS_RecursiveQueryFailurePerSecNULLProvides the average number of recursive query failures in each second.
DNS_RecursiveQueriesPerSecDNS_RecursiveQueriesPerSecNULLProvides the average number of recursive queries received by DNS server in each second.

Agent G2 - Fujitsu PRIMERGY Health - Windows

Description

Monitor the following metrics for Fujitsu PRIMERGY Health on Windows servers: fujitsu_primergy_host_raidController_healthState, fujitsu_primergy_host_raidController_primaryStatus, fujitsu_primergy_diskDrive_healthState, fujitsu_primergy_diskDrive_primaryStatus, fujitsu_primergy_temperature_healthState, fujitsu_primergy_temperature_currentState, fujitsu_primergy_temperature_currentReading, fujitsu_primergy_voltage_healthState, fujitsu_primergy_voltage_currentState, fujitsu_primergy_voltage_currentReading, fujitsu_primergy_powerSupply_healthState, fujitsu_primergy_powerConsumptionSensor_healthState, fujitsu_primergy_powerConsumptionSensor_currentState, fujitsu_primergy_fan_healthState, fujitsu_primergy_fan_sensor_healthState, fujitsu_primergy_fan_sensor_currentState, fujitsu_primergy_fan_sensor_currentReading, fujitsu_primergy_managementController_healthState, fujitsu_primergy_processor_healthState, fujitsu_primergy_memory_healthState, fujitsu_primergy_cache_memory_healthState, fujitsu_primergy_physical_memory_healthState

Note: This template will be applicable only for the Agent version 14.0.0 or later.

Prerequisites

This template will be applicable only for the Agent version 14.0.0 or later.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Fujitsu PRIMERGY Health - Windowsfujitsu_primergy_host_raidController_healthStatefujitsu_primergy_host_raidController_healthStatenullMonitors Fujitsu PGY Raid Controller Current Health State. The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_host_raidController_primaryStatusfujitsu_primergy_host_raidController_primaryStatusnullMonitors Fujitsu PGY Host Raid Controller PrimaryStatus, high-level status value intended to align with Red-Yellow-Green type representation of status. Supported values: 0: Unknown, 2: Warning - Warning; 3: Error - Critical; 1: OK - Ok
fujitsu_primergy_diskDrive_primaryStatusfujitsu_primergy_diskDrive_primaryStatusnullMonitors Fujitsu PGY DiskDrive Primary Status, high-level status value intended to align with Red-Yellow-Green type representation of status. Supported values: 0: Unknown, 2: Warning - Warning; 3: Error - Critical; 1: OK - Ok
fujitsu_primergy_temperature_healthStatefujitsu_primergy_temperature_healthStatenullMonitors Fujitsu PGY Temperature HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_temperature_currentStatefujitsu_primergy_temperature_currentStatenullCurrent state indicated by the Sensor. Lower Critical, Upper Critical, Critical - Critical; Unknown, Upper Non-Critical, Non-Critical - Warning; Normal - Ok
fujitsu_primergy_temperature_currentReadingfujitsu_primergy_temperature_currentReadingCCurrent value indicated by the Sensor.
fujitsu_primergy_voltage_healthStatefujitsu_primergy_voltage_healthStatenullMonitors Fujitsu PGY Voltage HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_voltage_currentStatefujitsu_primergy_voltage_currentStatenullCurrent state indicated by the Sensor. Lower Critical, Upper Critical, Critical - Critical; Unknown, Upper Non-Critical, Non-Critical - Warning; Normal - Ok
fujitsu_primergy_voltage_currentReadingfujitsu_primergy_voltage_currentReadingvCurrent value indicated by the Sensor
fujitsu_primergy_powerSupply_healthStatefujitsu_primergy_powerSupply_healthStatenullMonitors Fujitsu PGY PowerSupply HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_powerConsumptionSensor_healthStatefujitsu_primergy_powerConsumptionSensor_healthStatenullMonitors Fujitsu PGY Consumption Sensor HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_powerConsumptionSensor_currentStatefujitsu_primergy_powerConsumptionSensor_currentStatenullCurrent state indicated by the Sensor. Lower Critical, Upper Critical, Critical - Critical; Unknown, Upper Non-Critical, Non-Critical - Warning; Normal - Ok
fujitsu_primergy_fan_healthStatefujitsu_primergy_fan_healthStatenullMonitors Fujitsu PGY Fan HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_fan_sensor_healthStatefujitsu_primergy_fan_sensor_healthStatenullMonitors Fujitsu PGY Fan Sensor HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_fan_sensor_currentStatefujitsu_primergy_fan_sensor_currentStatenullCurrent state indicated by the Sensor. Lower Critical, Upper Critical, Critical - Critical; Unknown, Upper Non-Critical, Non-Critical - Warning; Normal - Ok
fujitsu_primergy_fan_sensor_currentReadingfujitsu_primergy_fan_sensor_currentReadingrpmCurrent value indicated by the Sensor
fujitsu_primergy_managementController_healthStatefujitsu_primergy_managementController_healthStatenullMonitors Fujitsu PGY Management Controller HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_processor_healthStatefujitsu_primergy_processor_healthStatenullMonitors Fujitsu PGY Processor HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_memory_healthStatefujitsu_primergy_memory_healthStatenullMonitors Fujitsu PGY Memory HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok
fujitsu_primergy_physical_memory_healthStatefujitsu_primergy_physical_memory_healthStatenullMonitors Fujitsu PGY Physical Memory HealthState.The possible values are 0 to 30, where 5 means that the object is entirely healthy and 30 means that the object is completely non-functional.. Supported values: 0: Unknown, 10: Degraded / Warning - Warning; 15: Predictive Failure, 20: Major failure, 25: Critical failure, 30: Non-functional - Critical; 5: OK - Ok

Agent G2 - Fujitsu PRIMERGY Health - Linux

Description

Template for Linux environment to monitor Fujitsu PRIMERGY Health Monitoring metrics like: Fujitsu PGY Host Raid Controller HealthState, Fujitsu PGY Host Raid Controller PrimaryStatus, Fujitsu PGY DiskDrive HealthState, Fujitsu PGY DiskDrive PrimaryStatus, Fujitsu PGY Temperature HealthState, Fujitsu PGY Temperature CurrentState, Fujitsu PGY Temperature CurrentReading, Fujitsu PGY Voltage HealthState, Fujitsu PGY Voltage CurrentState, Fujitsu PGY Voltage CurrentReading, Fujitsu PGY PowerSupply HealthState, Fujitsu PGY Power Consumption Sensor HealthState, Fujitsu PGY Power Consumption Sensor CurrentState, Fujitsu PGY Fan HealthState, Fujitsu PGY Fan Sensor HealthState, Fujitsu PGY Fan Sensor CurrentState, Fujitsu PGY Fan Sensor CurrentReading, Fujitsu PGY Management Controller HealthState, Fujitsu PGY Processor HealthState, Fujitsu PGY Memory HealthState, Fujitsu PGY Cache Memory HealthState, Fujitsu PGY Physical Memory HealthState.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Fujitsu PRIMERGY Health - Linuxfujitsu_pgy_management_controller_health_statePGY Management Controller Health StateNULLPGY Management Controller Health State
fujitsu_pgy_temperature_health_statePGY Temperature Health StateNULLPGY Temperature Health State
fujitsu_pgy_powerConsumption_sensor_health_statePGY Power Consumption Health StateNULLPGY Power Consumption Health State
fujitsu_pgy_voltage_health_statePGY Voltage Health StateNULLPGY Voltage Health State
fujitsu_pgy_diskdrive_health_statePGY Disk Drive Health StateNULLPGY Disk Drive Health State
fujitsu_pgy_temperature_current_statePGY Temperature Current StateNULLPGY Temperature Current State
fujitsu_pgy_fan_sensor_health_statePGY Fan Sensor Health StateNULLPGY Fan Sensor Health State
fujitsu_pgy_powersupply_health_statePGY Power Supply Health StateNULLPGY Power Supply Health State
fujitsu_pgy_cache_memory_health_statePGY Cache Memory Health StateNULLPGY Cache Memory Health State
fujitsu_pgy_diskdrive_primary_statusPGY Disk Drive Primary StatusNULLPGY Disk Drive Primary Status
fujitsu_pgy_voltage_current_valuePGY Voltage Current ValuevPGY Voltage Current Value
fujitsu_pgy_memory_health_statePGY Memory Health StateNULLPGY Memory Health State
fujitsu_pgy_fan_sensor_current_statePGY Fan Sensor Current StateNULLPGY Fan Sensor Current State
fujitsu_pgy_voltage_current_statePGY Voltage Current StateNULLPGY Voltage Current State
fujitsu_pgy_temperature_valuePGY Temperature ValueNULLPGY Temperature Value
fujitsu_pgy_fan_sensor_current_valuePGY Fan Sensor Current ValuerpmPGY Fan Sensor Current Value
fujitsu_pgy_powerConsumption_sensor_current_statePGY Power Consumption Current StateNULLPGY Power Consumption Current State
fujitsu_pgy_physical_memory_health_statePGY Physical Memory Health StateNULLPGY Physical Memory Health State
fujitsu_pgy_host_raidcontroller_health_statePGY Host Raid Controller Health StateNULLPGY Host Raid Controller Health State
fujitsu_pgy_host_raidcontroller_primary_statusPGY Host Raid Controller Primary StatusNULLPGY Host Raid Controller Primary Status
fujitsu_pgy_fan_health_statePGY Fan Health StateNULLPGY Fan Health State
fujitsu_pgy_processor_health_statePGY Processor Health StateNULLPGY Processor Health State

Agent G2 - Fujitsu PRIMERGY Health - Windows - DotNet v4

Description

Template for Windows environment (for .NET v4 or later) to monitor Fujitsu PRIMERGY Health Monitoring metrics like: Fujitsu PGY Host Raid Controller HealthState, Fujitsu PGY Host Raid Controller PrimaryStatus, Fujitsu PGY DiskDrive HealthState, Fujitsu PGY DiskDrive PrimaryStatus, Fujitsu PGY Temperature HealthState, Fujitsu PGY Temperature CurrentState, Fujitsu PGY Temperature CurrentReading, Fujitsu PGY Voltage HealthState, Fujitsu PGY Voltage CurrentState, Fujitsu PGY Voltage CurrentReading, Fujitsu PGY PowerSupply HealthState, Fujitsu PGY Power Consumption Sensor HealthState, Fujitsu PGY Power Consumption Sensor CurrentState, Fujitsu PGY Fan HealthState, Fujitsu PGY Fan Sensor HealthState, Fujitsu PGY Fan Sensor CurrentState, Fujitsu PGY Fan Sensor CurrentReading, Fujitsu PGY Management Controller HealthState, Fujitsu PGY Processor HealthState, Fujitsu PGY Memory HealthState, Fujitsu PGY Cache Memory HealthState, Fujitsu PGY Physical Memory HealthState.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Fujitsu PRIMERGY Health - Windows - DotNet v4fujitsu.pgy.temperature.currentreadingFujitsu PGY Temperature CurrentReadingNULLCurrent value indicated by the Sensor
fujitsu.pgy.voltage.currentreadingFujitsu PGY Voltage CurrentReadingNULLCurrent value indicated by the Sensor
fujitsu.pgy.fan.sensor.currentreadingFujitsu PGY Fan Sensor CurrentReadingNULLCurrent value indicated by the Sensor

Agent G2 - HyperV processorratio

Description

HyperV processorratio monitor Template

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - HyperV processorratioHyperv_VirtualtoLogicalProcessorRatioHyperv_VirtualtoLogicalProcessorRatioNULLShows the count ratio of HyperV Virtual and Logical Processors.

Agent G2 - K8s ApiServer Requests Advanced Metrics

Description

Monitors Apiserver Request Total and Apiserver Request Duration Seconds Bucket (verb = get, put, post) Metrics.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - K8s ApiServer Requests Advanced Metricsapiserver.post.requests.duration.secondsKube apiserver Post Requests Duration SecondsSecondsTime taken for POST API responses.
apiserver.get.requests.duration.secondsKube apiserver Get Requests Duration SecondsSecondsTime taken for GET API responses.
apiserver.requests.total.success.rateKube apiserver Requests Success RatePercentagePercentage of success API requests.
apiserver.put.requests.duration.secondsKube apiserver Put Requests Duration SecondsSecondsTime taken for PUT API responses.

Agent G2 - Kubernetes Pods Monitor

Description

Monitors pods of different kinds of kubernetes like Deployment, Daemonset, Replicasets and Statefulsets

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - k8spodsmonitorkubernetes_statefulset_pods_running_percentageStatefulSet Pods Running PercentagePercentagePercentage of pods running by desired pods of Statefulset.
kubernetes_daemonset_pods_running_percentageDaemonset Pods Running PercentagePercentagePercentage of pods running by desired pods of Daemonset.
kubernetes_deployment_pods_running_percentageDeployment Pods Running PercentagePercentagePercentage of pods running by desired pods of Deployment.
kubernetes_daemonset_pods_runningDaemonset Pods RunningCountThe number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready.
kubernetes_statefulset_pods_running_percentageStatefulSet Pods Running PercentagePercentagePercentage of pods running by desired pods of Statefulset.
kubernetes_daemonset_pods_desiredDaemonset Pods DesiredCountThe number of nodes that should be running the daemon pod.
kubernetes_statefulset_pods_desiredStatefulSet Pods DesiredCountNumber of desired pods for a StatefulSet.
kubernetes_deployment_pods_runningDeployment Pods RunningCountThe number of ready replicas per deployment.
kubernetes_replicaset_pods_desiredReplicaset Pods DesiredCountNumber of desired pods for a ReplicaSet.
kubernetes_statefulset_pods_desiredStatefulSet Pods DesiredCountNumber of desired pods for a StatefulSet.
kubernetes_deployment_pods_running_percentageDeployment Pods Running PercentagePercentagePercentage of pods running by desired pods of Deployment.
kubernetes_deployment_pods_runningDeployment Pods RunningCountThe number of ready replicas per deployment.
kubernetes_statefulset_pods_runningStatefulSet Pods RunningCountThe number of ready replicas per StatefulSet.
kubernetes_daemonset_pods_desiredDaemonset Pods DesiredCountThe number of nodes that should be running the daemon pod.
kubernetes_replicaset_pods_runningReplicaset Pods RunningCountThe number of ready replicas per ReplicaSet.
kubernetes_deployment_pods_desiredDeployment Pods DesiredCountNumber of desired pods for a deployment.
kubernetes_replicaset_pods_desiredReplicaset Pods DesiredCountNumber of desired pods for a ReplicaSet.
kubernetes_daemonset_pods_runningDaemonset Pods RunningCountThe number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready.
kubernetes_deployment_pods_desiredDeployment Pods DesiredCountNumber of desired pods for a deployment.
kubernetes_replicaset_pods_runningReplicaset Pods RunningCountThe number of ready replicas per ReplicaSet.
kubernetes_replicaset_pods_running_percentageReplicaset Pods Running PercentagePercentagePercentage of pods running by desired pods of Replicaset
kubernetes_replicaset_pods_running_percentageReplicaset Pods Running PercentagePercentagePercentage of pods running by desired pods of Replicaset.
kubernetes_daemonset_pods_running_percentageDaemonset Pods Running PercentagePercentagePercentage of pods running by desired pods of Daemonset.
kubernetes_statefulset_pods_runningStatefulSet Pods RunningCountThe number of ready replicas per StatefulSet.

Agent G2 - Linux - ActiveMQ Monitors

Description

Monitors ActiveMQ application metrics

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - ActiveMQ Monitorsactivemq.broker.memory.prctActiveMQ-BrokerMemoryPercentUsageNULLThe percent of memory limit used.
activemq.broker.temp.prctActiveMQ-BrokerTempPercentUsageNULLThe space used by the store for temporary messages.
activemq.broker.store.prctActiveMQ-BrokerStorePercentUsageNULLThe space used by the Message Store.
activemq.jvm.gc.collection_countActiveMQ-JVM.GC.collection_countNULLNumber of garbage objects collected
activemq.queue.consumer_countActiveMQ-ConsumerCountNULLNumber of consumers subscribed to this destination
activemq.queue.inflight_countActiveMQ-InFlightCountNULLNumber of messages sent to a destination and have not received an acknowledgement.
activemq.queue.producer_countActiveMQ-ProducerCountNULLNumber of producers
activemq.queue.enqueue_countActiveMQ-EnqueueCountNULLNumber of messages that have been sent to the destination since the last restart.
activemq.queue.dequeue_countActiveMQ-DequeueCountNULLNumber of messages that have been acknowledged (and removed) from the destination since last restart.
activemq.queue.sizeActiveMQ-QueueSizeNULLThe number of messages that currently reside in the queue. Potentially dispatched but unacknowledged.
activemq.jvm.threadsActiveMQ-JVM.ThreadsNULLNumber of threads.
activemq.jvm.uptimeActiveMQ-UptimeNULLUptime of the server
activemq.jvm.mem.non_heap_committedActiveMQ-JVM.Mem.non_heap_committedNULLNon-heap memory committed (in MB) for the server
activemq.jvm.open.fdsActiveMQ-JVM.OpenFDsNULLNumber of Open file descriptors of the server
activemq.jvm.mem.heap_usedActiveMQ-JVM.Mem.heap_usedNULLHeap memory usage (in MB) of the server
activemq.queue.avg_enqueuetimeActiveMQ-AverageEnqueueTimeNULLOn average, the amount of time (ms) that messages remained enqueued. Or average time it is taking the consumers to successfully process messages.
activemq.queue.memory.prctActiveMQ-QueueMemoryPercentUsageNULLThe percentage of the memory limit used by queues.
activemq.jvm.mem.non_heap_usedActiveMQ-JVM.Mem.non_heap_usedNULLNon-heap memory usage (in MB) of the server
activemq.queue.dispatch_countActiveMQ-DispatchCountNULLNumber of messages that have been dispatched (Dequeue + Inflight).
activemq.queue.expired_countActiveMQ-ExpiredCountNULLNumber of messages that were expired.
activemq.jvm.gc.collection_timeActiveMQ-JVM.GC.collection_timeNULLTime taken for collection of the garbage objects.
activemq.queue.max_enqueuetimeActiveMQ-MaxEnqueueTimeNULLThe maximum amount of time that messages remained enqueued.
activemq.jvm.mem.heap_committedActiveMQ-JVM.Mem.heap_committedNULLHeap memory committed (in MB) for the server

Agent G2 - Linux - ActiveMQ Performance Check

Description

Monitors ActiveMQ application metrics uses MBeans exposed via the JMX console. Please refer to OpsRamp documentation on how to enable JMX on your application.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - ActiveMQ Performance Checkactivemq.broker.memory.prctActiveMQ-BrokerMemoryPercentUsageNULLThe percent of memory limit used.
activemq.broker.temp.prctActiveMQ-BrokerTempPercentUsageNULLThe space used by the store for temporary messages.
activemq.broker.store.prctActiveMQ-BrokerStorePercentUsageNULLThe space used by the Message Store.
activemq.jvm.gc.collection_countActiveMQ-JVM.GC.collection_countNULLNumber of garbage objects collected
activemq.queue.consumer_countActiveMQ-ConsumerCountNULLNumber of consumers subscribed to this destination
activemq.queue.inflight_countActiveMQ-InFlightCountNULLNumber of messages sent to a destination and have not received an acknowledgement.
activemq.queue.producer_countActiveMQ-ProducerCountNULLNumber of producers
activemq.queue.enqueue_countActiveMQ-EnqueueCountNULLNumber of messages that have been sent to the destination since the last restart.
activemq.queue.dequeue_countActiveMQ-DequeueCountNULLNumber of messages that have been acknowledged (and removed) from the destination since last restart.
activemq.queue.sizeActiveMQ-QueueSizeNULLThe number of messages that currently reside in the queue. Potentially dispatched but unacknowledged.
activemq.jvm.threadsActiveMQ-JVM.ThreadsNULLNumber of threads.
activemq.jvm.uptimeActiveMQ-UptimeNULLUptime of the server
activemq.jvm.mem.non_heap_committedActiveMQ-JVM.Mem.non_heap_committedNULLNon-heap memory committed (in MB) for the server
activemq.jvm.open.fdsActiveMQ-JVM.OpenFDsNULLNumber of Open file descriptors of the server
activemq.jvm.mem.heap_usedActiveMQ-JVM.Mem.heap_usedNULLHeap memory usage (in MB) of the server
activemq.queue.avg_enqueuetimeActiveMQ-AverageEnqueueTimeNULLOn average, the amount of time (ms) that messages remained enqueued. Or average time it is taking the consumers to successfully process messages.
activemq.queue.memory.prctActiveMQ-QueueMemoryPercentUsageNULLThe percentage of the memory limit used by queues.
activemq.jvm.mem.non_heap_usedActiveMQ-JVM.Mem.non_heap_usedNULLNon-heap memory usage (in MB) of the server
activemq.queue.dispatch_countActiveMQ-DispatchCountNULLNumber of messages that have been dispatched (Dequeue + Inflight).
activemq.queue.expired_countActiveMQ-ExpiredCountNULLNumber of messages that were expired.
activemq.jvm.gc.collection_timeActiveMQ-JVM.GC.collection_timeNULLTime taken for collection of the garbage objects.
activemq.queue.max_enqueuetimeActiveMQ-MaxEnqueueTimeNULLThe maximum amount of time that messages remained enqueued.
activemq.jvm.mem.heap_committedActiveMQ-JVM.Mem.heap_committedNULLHeap memory committed (in MB) for the server

Agent G2 - Linux - Apache CouchDB Monitors

Description

Monitors CouchDB application metrics using the CouchDB’s API which is normally accessible via http://127.0.0.1:5984/

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Apache CouchDB Monitorscouchdb.httpd_status_codes.412CouchDB-Httpd412StatusNULLNumber of HTTP 412 Precondition Failed responses
couchdb.httpd_status_codes.404CouchDB-Httpd404StatusNULLNumber of HTTP 404 Not Found responses
couchdb.httpd.temporary_view_readsCouchDB-HttpTemporaryViewReadsNULLNumber of temporary view reads
couchdb.request_timeCouchDB-RequestTimemsLength of a request inside CouchDB without MochiWeb
couchdb.httpd_status_codes.202CouchDB-Httpd202StatusNullNumber of HTTP 202 Accepted responses
couchdb.disk_sizeCouchDB-DiskSizeNULLTotal size Disk for all dbs
couchdb.database_readsCouchDB-DatabaseReadsNULLNumber of times a document was read from a database
couchdb.databases_openCouchDB-OpenDatabasesNULLNumber of open databases
couchdb.httpd_request_methods_deleteCouchDB-DELETERequestsNULLNumber of HTTP DELETE requests
couchdb.httpd_status_codes.403CouchDB-Httpd403StatusNULLNumber of HTTP 403 Forbidden responses
couchdb.httpd_status_codes.201CouchDB-Httpd201StatusNULLNumber of HTTP 201 Created responses
couchdb.httpd.clients_requesting_changesCouchDB-HttpClientsRequestingChangesNULLNumber of clients for continuous _changes
couchdb.database_writesCouchDB-DatabaseWritesNULLNumber of times a database was changed
couchdb.open_fdsCouchDB-OpenFDsNULLNumber of file descriptors CouchDB has open
couchdb.httpd_status_codes.405CouchDB-Httpd405StatusNULLNumber of HTTP 405 Method Not Allowed responses
couchdb.httpd_request_methods_headCouchDB-HEADRequestsNULLNumber of HTTP HEAD requests
couchdb.httpd.requestsCouchDB-HttpRequestsNULLNumber of HTTP requests
couchdb.httpd_status_codes.301CouchDB-Httpd301StatusNULLNumber of HTTP 301 Moved Permanently responses
couchdb.httpd_request_method_postCouchDB-POSTRequestsNULLNumber of HTTP POST requests
couchdb.cache_hitsCouchDB-CacheHitsNULLNumber of authentication cache hits
couchdb.httpd_request_methods_getCouchDB-GETRequestsNULLNumber of HTTP GET requests
couchdb.httpd_status_codes.400CouchDB-Httpd400StatusNULLNumber of HTTP 400 Bad Request responses
couchdb.httpd.bulk_requestsCouchDB-HttpBulkRequestsNULLNumber of bulk requests
couchdb.doc_countCouchDB-DocCountNULLNumber doc's in all dbs
couchdb.cache_missesCouchDB-CacheMissesNULLNumber of authentication cache misses
couchdb.httpd_status_codes.304CouchDB-Httpd304StatusNULLNumber of HTTP 304 Not Modified responses
couchdb.httpd.view_readsCouchDB-HttpViewReadsNULLNumber of view reads
couchdb.httpd_status_codes.401CouchDB-Httpd401StatusNULLNumber of HTTP 401 Unauthorized responses
couchdb.httpd_status_codes.200CouchDB-Httpd200StatusNULLNumber of HTTP 200 OK responses
couchdb.httpd_status_codes.409CouchDB-Httpd409StatusNULLNumber of HTTP 409 Conflict responses
couchdb.httpd_request_methods_putCouchDB-PUTRequestsNULLNumber of HTTP PUT requests
couchdb.httpd_request_methods_copyCouchDB-COPYRequestsNULLNumber of HTTP COPY requests
couchdb.httpd_status_codes.500CouchDB-Httpd500StatusNULLNumber of HTTP 500 Internal Server Error responses

Agent G2 - Linux - Kubernetes Metric Server - v2

Description

Template for monitoring Kubernetes using Kubernetes Metric Server. Template “Agent G2 - Linux - Kubernetes Metric Server” does not currently support customizing the namespace. In this v2 template, there is an option to monitor the “kube-system” namespace by default, and customers could specify a different namespace if needed.

Prerequisites

No Prerequisites.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Kubernetes Metric Server Monitor - v2metrics_server.authenticated_user_requestsAuthenticated User RequestsnullCounter of authenticated requests broken out by username.
metrics_server.go_gc_duration_seconds_countGo GC Duration Seconds CountnullA summary of the GC invocation durations.
metrics_server.go_gc_duration_seconds_quantileGo GC Duration Seconds QuantileSecondsA summary of the GC invocation durations.
metrics_server.go_gc_duration_seconds_sumGo GC Duration Seconds SumnullA summary of the GC invocation durations.
metrics_server.go_goroutinesGo GoroutinesnullNumber of goroutines that currently exist.
metrics_server.kubelet_summary_request_duration_countKubelet Summary Request Duration CountnullThe Kubelet summary request latencies in seconds.
metrics_server.kubelet_summary_request_duration_sumKubelet Summary Request Duration SumnullThe Kubelet summary request latencies in seconds.
metrics_server.kubelet_summary_scrapes_totalKubelet Summary Scrapes TotalnullTotal number of attempted Summary API scrapes done by Metrics Server.
metrics_server.manager_tick_duration_countManager Tick Duration CountnullThe total time spent collecting and storing metrics in seconds.
metrics_server.manager_tick_duration_sumManager Tick Duration SumnullThe total time spent collecting and storing metrics in seconds.
metrics_server.process_cpu_seconds_totalProcess Cpu Seconds TotalnullTotal user and system CPU time spent in seconds.
metrics_server.process_max_fdsProcess Max FdsnullMaximum number of open file descriptors.
metrics_server.process_open_fdsProcess Open FdsnullNumber of open file descriptors.
metrics_server.scraper_duration_countScraper Duration CountnullTime spent scraping sources in seconds.
metrics_server.scraper_duration_sumScraper Duration SumnullTime spent scraping sources in seconds.
metrics_server.scraper_last_timeScraper Last TimenullLast time metrics-server performed a scrape since unix epoch in seconds.

Agent G2 - Linux - Memcache Monitors

Description

Monitors Memcache application metrics

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Memcache Monitorsmemcache.curr_connectionsMemcache-CurrentConnectionsNULLNumber of open connections
memcache.memory_usedMemcache-MemoryUsedNULLTotal memory used by the server engine
memcache.uptimeMemcache-UptimeNULLNumber of minutes this server has been running
memcache.tempoom_rateMemcache-TempOOMPersecNULLNumber of temporary out-of-memory errors sent to clients per second.
memcache.gets_rateMemcache-GetsPersecNULLCumulative number of get requests for node per second
memcache.sets_rateMemcache-SetsPersecNULLCumulative number of set requests for node per second
memcache.avg_item_sizeMemcache-AvgItemSizeNULLAverage size of an item
memcache.misses_rateMemcache-MissesPersecNULLNumber of items that have been requested but not found per second.
memcache.bytes_written_rateMemcache-WrittenBytesPersecNULLAverage data written by this server in a second from the network in MB
memcache.fill_percentMemcache-FillPercentNULLPercentage of bytes used by this server
memcache.ratio.resident.itemMemcache-ResidentItemRatioNULLPercentage of items that are resident (in RAM)
memcache.cas_hits_rateMemcache-CASHitsPersecNULLNumber of successful CAS operations per second.
memcache.evictions_rateMemcache-EvictionsPersecNULLNumber of valid items removed per second, from cache to free memory for new items.
memcache.bytes_read_rateMemcache-ReadBytesPersecNULLAverage data read by this server in a second from the network in MB.
memcache.get_hit_percentMemcache-GetHitPercentNULLPercentage number of keys that have been requested and found. This value must be more for an optimal performance.
memcache.connections_rateMemcache-ConnectionsPersecNULLAverage number of connections per second
memcache.ops_rateMemcache-OpsPersecNULLNumber of total operations for node per second.
memcache.hits_rateMemcache-HitsPersecNULLNumber of keys that have been requested and found per second.
memcache.disk_reads_rateMemcache-DiskReadsPersecNULLNumber of items fetched from disk.
memcache.cas_badval_rateMemcache-CASBadvalPersecNULLNumber of CAS operations per second that failed to modify a value due to a bad CAS id
memcache.curr_itemsMemcache-CurrentItemsNULLCurrent number of items stored by the server.
memcache.ratio.cache.missMemcache-CacheMissRatioNULLPercentage number of items fetched from disk against total requests.
memcache.cas_misses_rateMemcache-CASMissesPersecNULLNumber of CAS operations per second against missing keys.
memcache.delete_hits_rateMemcache-DeletesPersecNULLNumber of successful deletions per second

Agent G2 - Linux - Memcached Performance Check

Description

Monitors Memcache application metrics

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Memcached Performance Checkmemcache.curr_connectionsMemcache-CurrentConnectionsNULLNumber of open connections
memcache.memory_usedMemcache-MemoryUsedNULLTotal memory used by the server engine
memcache.uptimeMemcache-UptimeNULLNumber of minutes this server has been running
memcache.tempoom_rateMemcache-TempOOMPersecNULLNumber of temporary out-of-memory errors sent to clients per second.
memcache.gets_rateMemcache-GetsPersecNULLCumulative number of get requests for node per second
memcache.sets_rateMemcache-SetsPersecNULLCumulative number of set requests for node per second
memcache.avg_item_sizeMemcache-AvgItemSizeNULLAverage size of an item
memcache.misses_rateMemcache-MissesPersecNULLNumber of items that have been requested but not found per second.
memcache.bytes_written_rateMemcache-WrittenBytesPersecNULLAverage data written by this server in a second from the network in MB
memcache.fill_percentMemcache-FillPercentNULLPercentage of bytes used by this server
memcache.ratio.resident.itemMemcache-ResidentItemRatioNULLPercentage of items that are resident (in RAM)
memcache.cas_hits_rateMemcache-CASHitsPersecNULLNumber of successful CAS operations per second.
memcache.evictions_rateMemcache-EvictionsPersecNULLNumber of valid items removed per second, from cache to free memory for new items.
memcache.bytes_read_rateMemcache-ReadBytesPersecNULLAverage data read by this server in a second from the network in MB.
memcache.get_hit_percentMemcache-GetHitPercentNULLPercentage number of keys that have been requested and found. This value must be more for an optimal performance.
memcache.connections_rateMemcache-ConnectionsPersecNULLAverage number of connections per second
memcache.ops_rateMemcache-OpsPersecNULLNumber of total operations for node per second.
memcache.hits_rateMemcache-HitsPersecNULLNumber of keys that have been requested and found per second.
memcache.disk_reads_rateMemcache-DiskReadsPersecNULLNumber of items fetched from disk.
memcache.cas_badval_rateMemcache-CASBadvalPersecNULLNumber of CAS operations per second that failed to modify a value due to a bad CAS id
memcache.curr_itemsMemcache-CurrentItemsNULLCurrent number of items stored by the server.
memcache.ratio.cache.missMemcache-CacheMissRatioNULLPercentage number of items fetched from disk against total requests.
memcache.cas_misses_rateMemcache-CASMissesPersecNULLNumber of CAS operations per second against missing keys.
memcache.delete_hits_rateMemcache-DeletesPersecNULLNumber of successful deletions per second

Agent G2 - Linux - Memory Statistics

Description

Agent G2 - Linux - Memory Statistics

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Memory StatisticsPhysicalMemoryPhysical MemoryMBPhysical memory information
memory.stats.swapping.rateVirtual Memory Swapping RateKB/sRate of swapping the entire process from physical memory to disk and vice-versa.
memory.stats.swap.util.rateSwap Memory Usage RateNULLRate of swap memory utilization.
memory.stats.physical.util.ratePhysical Memory Usage RateNULLRate of physical memory utilization.
SwapMemorySwap MemoryMBSwap memory information.
memory.stats.paging.rateVirtual Memory Paging RateKB/sRate of swapping least used process memory blocks from physical memory to disk and vice-versa.

Agent G2 - Linux - Mesos Agent Monitoring Template

Description

Agent G2 - Linux - Mesos Agent Monitoring Template

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Mesos Agent Monitoring Templatemesos.slave.tasks_runningTasks runningNULLNumber of running tasks
mesos.slave.invalid_framework_messagesInvalid framework messagesNULLNumber of invalid framework messages
mesos.slave.frameworks_activeFrameworks activeNULLNumber of active frameworks
mesos.slave.disk_percentAllocated disk space percentNULLPercentage of allocated disk space
mesos.slave.tasks_lostTasks lostNULLNumber of lost tasks
mesos.slave.executors_terminatedExecutors terminatedNULLNumber of executors terminated
mesos.slave.gpus_percentAllocated GPUs percentNULLPercentage of allocated GPUs
mesos.slave.cpus_usedNumber of CPUs usedNULLNumber of allocated CPUs
mesos.slave.tasks_startingTasks startingNULLNumber of starting tasks
mesos.slave.valid_framework_messagesValid framework messagesNULLNumber of valid framework messages
mesos.state.task.cpuTask cpuNULLTask cpu
mesos.slave.invalid_status_updatesInvalid status updatesNULLNumber of invalid status updates
mesos.slave.valid_status_updatesMesos slave valid_status_updatesNULLNumber of valid status updates
mesos.stats.system.load_15minMesos stats system load_15minNULLLoad average for the past 15 minutes
mesos.slave.disk_totalDisk space totalNULLDisk space
mesos.slave.mem_totalMemory totalNULLTotal memory
mesos.slave.recovery_errorsRecovery errorsNULLNumber of errors encountered during slave recovery
mesos.stats.uptime_secsUptime secondsNULLSlave uptime
mesos.slave.executors_runningExecutors runningNULLNumber of executors running
mesos.slave.mem_percentAllocated memory percentNULLPercentage of allocated memory
mesos.stats.system.mem_total_bytesMesos stats system mem_total_bytesNULLTotal memory
mesos.slave.disk_usedAllocated disk spaceNULLAllocated disk space
mesos.slave.executors_terminatingExecutors terminatingNULLNumber of executors terminating
mesos.slave.tasks_finishedTasks finishedNULLNumber of finished tasks
mesos.slave.gpus_usedNumber of GPUs usedNULLNumber of allocated GPUs
mesos.slave.cpus_totalCPUs totalNULLNumber of CPUs
mesos.slave.mem_usedAllocated memoryNULLUsed memory
mesos.stats.system.load_1minMesos stats system load_1minNULLLoad average for the past 1 minute
mesos.slave.tasks_stagingTasks stagingNULLNumber of staging tasks
mesos.state.task.memTask memNULLTask memory
mesos.slave.executors_registeringExecutors registeringNULLNumber of executors registering
mesos.slave.tasks_failedTasks failedNULLNumber of failed tasks
mesos.slave.cpus_percentAlloated CPUs percentNULLPercentage of allocated CPUs
mesos.stats.system.mem_free_bytesMesos stats system mem_free_bytesNULLFree memory
mesos.stats.system.load_5minMesos stats system load_5minNULLLoad average for the past 5 minutes
mesos.state.task.diskTask diskNULLTask disk
mesos.stats.system.cpus_totalNumber of CPUsNULLNumber of CPUs
mesos.slave.gpus_totalGPUs totalNULLNumber of GPUs
mesos.slave.tasks_killedTasks killedNULLNumber of killed tasks

Agent G2 - Linux - Mesos Master Monitoring Template

Description

Mesos Master Monitoring Template

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Mesos Master Monitoring Templatemarathon.queue.offers.reject.lastMarathon Queue Offeres Reject LastNULLSummary of unused offers for all last offers
mesos.role.diskMesos Role DiskNULLMesos Role Disk
marathon.queue.offers.unusedMarathon Queue Offers UnusedNULLThe number of unused offers for this launch attempt
dcos.health.admin.router.agentAdmin router agent service healthNULLAdmin Router Agent
mesos.cluster.slaves_unreachableAgents unreachableNULLNumber of unreachable agents. Unreachable agents are periodically garbage collected from the registry, which will cause this value to decrease.
dcos.health.telegraf.socketTelegraf socket healthNULLTelegraf Socket
marathon.instancesMarathon InstancesNULLNumber of instances of a given application
marathon.queue.sizeMarathon Queue SizeNULLNumber of app offer queues
dcos.health.component.package.managerComponent Package Manager (Pkgpanda) service healthNULLDC/OS Component Package Manager (Pkgpanda)
mesos.stats.electedElected as masterNULLWhether this is the elected master
mesos.cluster.mem_percentAllocated memory percentNULLPercentage of allocated memory
mesos.registrar.state_store_ms.p9999Registrar state_store_ms.p9999NULL99.99th percentile registry write latency in ms
marathon.backoffSecondsMarathon Backoff SecondsNULLTask backoff period
dcos.health.telegrafTelegraf service healthNULLTelegraf
mesos.cluster.mem_usedAllocated memoryNULLAllocated memory in MB
mesos.cluster.frameworks_activeFrameworks activeNULLNumber of active frameworks
dcos.health.signal.timerSignal Timer service healthNULLDC/OS Signal Timer
marathon.queue.countMarathon Queue CountNULLNumber of instances left to launch
dcos.health.signalSignal service healthNULLDC/OS Signal
dcos.health.marathonMarathon service healthNULLMarathon
mesos.cluster.invalid_status_updatesInvalid status updatesNULLNumber of invalid status updates
mesos.registrar.state_store_ms.p999Registrar state_store_ms.p999NULL99.9th percentile registry write latency in ms
dcos.health.log.agentAgent Log service healthNULLDC/OS Log Agent
dcos.health.diagnostics.agent.socketDiagnostics Agent socket healthNULLDC/OS Diagnostics Agent Socket
mesos.cluster.disk_usedAllocated disk spaceNULLAllocated disk space in MB
mesos.cluster.gpus_usedNumber of GPUs usedNULLNumber of allocated GPUs
mesos.cluster.tasks_errorInvalid tasksNULLNumber of tasks that were invalid
mesos.registrar.state_store_ms.maxMax registry write latencyNULLMaximum registry write latency in ms
dcos.health.authenticationAuthentication service healthNULLDC/OS Authentication (OAuth)
mesos.cluster.event_queue_http_requestsEvent queue HTTP requestsNULLNumber of HTTP requests in the event queue
marathon.queue.offers.reject.launchMarathon Queue Offeres Reject LaunchNULLSummary of unused offers for the launch attempt
mesos.cluster.event_queue_messagesEvent queue messagesNULLNumber of messages in the event queue
mesos.registrar.state_store_ms.p50Registrar state_store_ms.p50NULLMedian registry write latency in ms
mesos.cluster.frameworks_disconnectedFrameworks disconnectedNULLNumber of disconnected frameworks
mesos.cluster.slaves_inactiveAgents inactiveNULLNumber of inactive agents
mesos.stats.system.load_5minMesos stats system load_5minNULLLoad average for the past 5 minutes
mesos.cluster.tasks_failedFailed tasksNULLNumber of failed tasks
mesos.cluster.cpus_totalCPUs totalNULLNumber of CPUs
dcos.health.mesos.masterMesos Master service healthNULLMesos Master
dcos.health.mesos.agent.publicMesos Public Agent service healthNULLMesos Agent Public
mesos.stats.system.load_15minMesos stats system load_15minNULLLoad average for the past 15 minutes
mesos.cluster.valid_status_update_acknowledgementsValid status update acknowledgement messagesNULLNumber of valid status update acknowledgement messages
mesos.registrar.state_store_ms.countRegistry write countNULLRegistry write count
mesos.cluster.slaves_connectedAgents connectedNULLNumber of connected agents
mesos.cluster.tasks_finishedTasks finishedNULLNumber of finished tasks
dcos.health.mesos.agentMesos Agent service healthNULLMesos Agent
dcos.health.mesos.dnsMesos DNS service healthNULLMesos DNS
mesos.cluster.frameworks_inactiveFrameworks inactiveNULLNumber of inactive frameworks
mesos.cluster.gpus_totalGPUs totalNULLNumber of GPUs
mesos.registrar.state_store_msRegistry write latencyNULLRegistry write latency in ms
mesos.framework.memMesos Framework MemoryNULLMesos Framework Memory
marathon.tasksHealthyMarathon Tasks HealthyNULLNumber of healthy tasks for a given application
dcos.health.logrotate.agent.timerLogrotate TimerNULLLogrotate Timer
dcos.health.net.watchdogNet Watchdog service healthNULLDC/OS Net Watchdog
dcos.health.admin.router.masterAdmin router master service healthNULLAdmin Router Master
dcos.health.jobsJobs (Metronome) service healthNULLDC/OS Jobs (Metronome)
dcos.health.resolv.timerGenerate resolv.conf Timer service healthNULLGenerate resolv.conf Timer
mesos.cluster.tasks_startingTasks startingNULLNumber of starting tasks
marathon.deploymentsMarathon DeploymentsNULLNumber of running or pending deployments
dcos.health.package.managerPackage Manager (Cosmos) service healthNULLDC/OS Package Manager (Cosmos)
dcos.health.log.agent.socketAgent Log socket healthNULLDC/OS Log Socket
dcos.health.checks.timerChecks Timer service healthNULLDC/OS Checks Timer
mesos.cluster.cpus_usedNumber of CPUs usedNULLNumber of allocated CPUs
dcos.health.diagnostics.agentDiagnostics Agent service healthNULLDC/OS Diagnostics Agent
marathon.taskRateLimitMarathon Task Rate LimitNULLThe task rate limit for a given application
mesos.cluster.recovery_slave_removalsAgents removalsNULLNumber of agent removed for various reasons, including maintenance.
mesos.stats.system.cpus_totalNumber of CPUsNULLNumber of CPUs
marathon.tasksStagedMarathon Tasks StagedNULLNumber of tasks staged for a given application
mesos.role.cpuMesos Role CPUNULLMesos Framework Disk
marathon.queue.offers.processedMarathon Queue Offers ProcessedNULLThe number of processed offers for this launch attempt
mesos.cluster.tasks_runningTasks runningNULLNumber of running tasks
mesos.cluster.event_queue_dispatchesDispatches in the event queueNULLNumber of dispatches in the event queue
dcos.health.log.masterMaster Log service healthNULLDC/OS Log Master
dcos.health.poststart.checksPoststart Checks service healthNULLDC/OS Poststart Checks
mesos.stats.system.mem_free_bytesMesos stats system mem_free_bytesNULLFree memory
mesos.stats.uptime_secsUptime secondsNULLSlave uptime
marathon.diskMarathon DISKNULLConfigured DISKs for each instance of a given application
mesos.registrar.log.recoveredRegistrar log recoveredNULLWhether the replicated log for the registrar has caught up with the other masters in the cluster. A cluster is operational as long as a quorum of "recovered" masters is available in the cluster.
mesos.registrar.queued_operationsMesos Registrar queued_operationsNULLMesos Registrar queued_operations
dcos.health.logrotate.masterMaster Logrotate service healthNULLLogrotate Mesos Master
mesos.cluster.mem_totalMemory totalNULLMemory in MB
marathon.cpusMarathon CPUsNULLConfigured CPUs for each instance of a given application
mesos.cluster.cpus_percentAlloated CPUs percentNULLPercentage of allocated CPUs
mesos.cluster.outstanding_offersOutstanding resource offersNULLNumber of outstanding resource offers
mesos.cluster.slaves_disconnectedAgents disconnectedNULLNumber of disconnected agents
mesos.stats.system.mem_total_bytesMesos stats system mem_total_bytesNULLTotal memory
mesos.cluster.slave_shutdowns_scheduledSlave shutdowns scheduledNULLNumber of slaves which have failed their health check and are scheduled to be removed
mesos.registrar.state_store_ms.p99Registrar state_store_ms.p99NULL99th percentile registry write latency in ms
mesos.cluster.gpus_percentAllocated GPUs percentNULLPercentage of allocated GPUs
marathon.backoffFactorMarathon Backoff FactorNULLBackoff time multiplication factor for each consecutive failed task launch.
dcos.health.historyHistory service healthNULLDC/OS History
dcos.health.checks.apiChecks API service healthNULLDC/OS Checks API
mesos.cluster.tasks_lostTasks lostNULLNumber of lost tasks
dcos.health.resolvGenerate resolv.conf service healthNULLGenerate resolv.conf
mesos.cluster.valid_framework_to_executor_messagesValid framework to executor messagesNULLNumber of valid framework to executor messages
dcos.health.netNet service healthNULLDC/OS Net
mesos.framework.diskMesos Framework DiskNULLMesos Framework Disk
marathon.tasksUnhealthyMarathon Tasks UnhealthyNULLNumber of unhealthy tasks for a given application
mesos.cluster.valid_status_updatesValid status update messagesNULLNumber of valid status update messages
mesos.framework.cpuMesos Framework CPUNULLMesos Framework CPU
mesos.cluster.frameworks_connectedFrameworks connectedNULLNumber of connected frameworks
dcos.health.log.master.socketMaster Log socket healthNULLDC/OS Log Socket
mesos.cluster.invalid_status_update_acknowledgementsNumber of invalid operation status update acknowledgementsNULLNumber of invalid operation status update acknowledgements
mesos.cluster.invalid_framework_to_executor_messagesInvalid framework to executor messagesNULLNumber of invalid framework to executor messages
dcos.health.gc.timerDocker GC TimerNULLDocker GC Timer
mesos.cluster.tasks_killedTasks killedNULLNumber of killed tasks
mesos.stats.system.load_1minMesos stats system load_1minNULLLoad average for the past 1 minute
dcos.health.exhibitorExhibitor service healthNULLExhibitor
mesos.cluster.slave_shutdowns_canceledSlave shutdowns canceledNULLNumber of cancelled slave shutdowns
mesos.role.memMesos Role MemoryNULLMesos Role Memory
mesos.cluster.slave_registrationsSlave registrationsNULLNumber of agent registrations
mesos.cluster.disk_percentAllocated disk space percentNULLPercentage of allocated disk space
mesos.registrar.state_store_ms.p95Registrar state_store_ms.p95NULL95th percentile registry write latency in ms
dcos.health.logrotate.master.timerLogrotate TimerNULLLogrotate Timer
dcos.health.rexrayREX-Ray service healthNULLREX-Ray
mesos.cluster.dropped_messagesDropped messagesNULLNumber of dropped messages
marathon.queue.delayMarathon Queue DelayNULLWait before the next launch attempt
marathon.memMarathon MemoryNULLConfigured memory for each instance of a given application
dcos.health.checks.api.socketChecks API socket healthNULLDC/OS Checks API Socket
mesos.cluster.slave_removalsSlave removalsNULLNumber of agent removed for various reasons, including maintenance
marathon.tasksRunningMarathon Tasks RunningNULLNumber of tasks running for a given application
mesos.registrar.state_fetch_msRegistry read latencyNULLRegistry read latency in ms
mesos.registrar.state_store_ms.p90Registrar state_store_ms.p90NULL90th percentile registry write latency in ms
mesos.cluster.tasks_stagingTasks stagingNULLNumber of staging tasks
mesos.registrar.registry_size_bytesMesos Registrar registry_size_bytesNULLMesos Registrar registry_size_bytes
mesos.cluster.disk_totalDisk space totalNULLDisk space in MB
mesos.cluster.slaves_activeAgents activeNULLNumber of active agents
dcos.health.logrotate.agentAgent Logrotate service healthNULLLogrotate Mesos Agent
mesos.cluster.slave_reregistrationsSlave reregistrationsNULLNumber of agent re-registrations
mesos.registrar.state_store_ms.minMin registry write latencyNULLMinimum registry write latency in ms
dcos.health.gcDocker GCNULLDocker GC
marathon.appsMarathon Applications CountNULLNumber of applications

Agent G2 - Linux - MongoDB API Based Status and Performance Check

Description

Monitors the MongoDB using the MongoDB API.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - MongoDB API Based Status and Performance Checkmongo.network.requestsMongoDB Network RequestsNULLNetwork Requests per second
mongo.btreeMongoDB BTreeNULLProvides Index Counters details as Accesses, Hits, Misses, Resets, Miss_ratio
mongo.heap.usageMongoDB Heap UsageNULLHeap Usage
mongo.assertsMongoDB AssertsNULLProvides the Mongo DB asserts
mongo.sizeMongoDB SizeNULLProvides the size of individual databases in Gigabytes
mongo.journaled.statusMongoDB Journaled StatusNULLProvides the Mongo DB journaledstatus
mongo.memoryMongoDB MemoryNULLMongo DB resident, virtual, mapped memory
mongo.index.miss.ratioMongoDB Index Miss RatioNULLProvides the Mongo DB index miss ratio
mongo.pagefaultsMongoDB Page FaultsNULLPage Faults
mongo.current.queueMongoDB Current QueueNULLCurrent readers and writers in Queue
mongo.lock.percentMongoDB Lock PercentNULLLock percentage
mongo.index.sizeMongoDB Index SizeNULLProvides the Index size of databases in KBs
mongo.journal.commitsMongoDB Journal Commits In WLNULLProvides the number of journal commits that occurred in the write lock
mongo.replication.lagMongoDB Replication LagNULLChecks the replication lag
mongo.op.countersMongoDB OP CountersNULLProvides opcounts for operations like insert, update, query, delete, getmore, command
mongo.cursorsMongoDB CursorsNULLProvides the Mongo DB cursors
mongo.trafficMongoDB TrafficNULLMongoDB current available traffic
mongo.active.clientsMongoDB Active ClientsNULLCurrent active, read and write clients
mongo.connectionsMongoDB ConnectionsNULLMongo DB current and available connections
mongo.avg.flushMongoDB Background Avg FlushNULLProvides the background average flush of dbs
mongo.uptimeMongoDB UptimeNULLUptime in minutes

Agent G2 - Linux - MongoDB Shard (mongos) Performance Check

Description

Monitors the mongos metric. This requires the python-pymongo package to be install. Check OpsRamp documents for more information

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - MongoDB Shard Mongos Performance Checkmongos.chunksMongos ChunksNULLTotal number of mongos chunks
mongos.chunks.balanceMongos Chunks BalanceNULLProvides Mongos chunks balance b/w database and collections
mongos.shardsMongos ShardsNULLTotal number of mongos shards
mongos.collectionsMongos CollectionsNULLTotal number of mongos sharded collections

Agent G2 - Linux - MongoDB Shard(Mongos) Monitors

Description

Monitors the mongos metric. This requires the python-pymongo package to be install. Check OpsRamp documents for more information.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - MongoDB Shard Mongos Monitorsmongos.chunks.balanceMongos Chunks BalanceNULLProvides Mongos chunks balance b/w database and collections
mongos.shardsMongos ShardsNULLTotal number of mongos shards
mongos.chunksMongos ChunksNULLTotal number of mongos chunks
mongos.collectionsMongos CollectionsNULLTotal number of mongos sharded collections

Agent G2 - Linux - MongoDB Status and Performance Check

Description

Monitoring Template for Mongo database application. This monitor requires the python-pymongo package to be installed on the server. Check OpsRamp documentation for more information.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - MongoDB Status and Performance Checkmongodb.networkrequestsMongoDB-NetworkRequestsNULLNetwork Requests per second
mongodb.sizeMongoDB-SizeNULLProvides the size of individual databases in Gigabytes
mongodb.activeclientsMongoDB-ActiveClientsNULLCurrent active, read and write clients
mongodb.pagefaultsMongoDB-PageFaultsNULLPage Faults
mongodb.replicaprimaryMongoDB-ReplicaPrimaryNULLCheck if the primary server of a replica set has changed
mongodb.btreeMongoDB-BTreeNULLProvides Index Counters details as Accesses, Hits, Resets, Miss_ratio
mongodb.replicationlagMongoDB-ReplicationLagNULLChecks the replication lag
mongodb.opcountersMongoDB-OPCountersNULLProvides opcounts for operations like insert, update, query, delete, getmore, command
mongodb.lockMongoDB-LockNULLLock percentage
mongodb.assertsMongoDB-AssertsNULLThe number of regular, warning, msg, user and rollovers asserts raised since this process started
mongodb.cursorsMongoDB-CursorsNULLThe number of cursors that the server is maintaining for clients and that have timed out since this server was started
mongodb.uptimeMongoDB-UptimeNULLUptime in minutes
mongodb.heapusageMongoDB-HeapUsageNULLHeap Usage
mongodb.connectionsMongoDB-ConnectionsNULLMongoDB current and available connections
mongodb.replicationstateMongoDB-ReplicationStateNULLReplication states will be the following cases: StartingPhase1(0), Primary(1), Secondary(2), Recoverying(3), Fatal Error(4), StartingPhase2(5), Arbiter(7), Down(8), Not_Running_with_Replication(-1)
mongodb.indexsizeMongoDB-IndexSizeNULLProvides the Index size of databases in KBs
mongodb.background_avg_flushMongoDB-BackgroundAvgFlushNULLmongod writes to and flushes (fsyncs) the journal immediately. Data files are flushes only occasionally and in the background. By default these flushes occur every 60 seconds.
mongodb.memoryMongoDB-MemoryNULLMongoDB resident, virtual, mapped memory
mongodb.currentqueueMongoDB-CurrentQueueNULLCurrent readers and writers in Queue
mongodb.journaled_statusMongoDB-JournaledStatusNULLThe average amount of data in megabytes written to the recovery log in the last four seconds is the JournaledMB and the data written to the databases datafiles in the last four seconds is writeToDataFilesMB.

Agent G2 - Linux - MySQL Advanced Monitors

It monitors the mysql.Innodb_log_waits, mysql.long_running_procs, and mysqlindex_usage metrics.

Prerequisites

Provide database names as input arguments separated by commas when applying the template at the device level.

Syntax: DBName1,DBName2

Parameters

NameDescriptionDefault value
MySQL DBnameDbnames to collect the metric dataNA
MySQL IPAddressIPAddress of the server where mysql is running127.0.0.1
MySQL PasswordPassword of the given usernameNA
MySQL PortPort on which mysql is running3306
MySQL UsernameUsername to connect to mysqlNA

Note: All field attributes are mandatory. Please use default values wherever applicable.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - MySQL Advanced Monitorsmysql.Innodb_log_waitsMysql Innodb log waitsNULLThe number of times that the log buffer was too small, and a wait was required for it to be flushed before continuing.
mysql.long_running_procsMysql long running processNULLTotal running process longer than 1 minute in a specific db.
mysqlindex_usageMysql Index UsageNULLThe sum of index lengths for the tables within the specified database.

Agent G2 - Linux NFS Mount Point Monitoring - v5

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization. In Version 5 of the template, we introduced enhanced functionality to exclude specific users given in input while checking mount point writability. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points(i.e. only nfs mounts present in /etc/fstab).Pre-Requisites: NFS needs to be installed and 1 or more NFS Mount points should be available on target device. Agent must be installed as root.

Template Usage Guidelines

While applying this template on the device, users need to provide specific input parameters in below two formats only(Case-Insensitive) -

Format 1: MountType:All;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors both temporary and permanent mount points, this is the default value)

Format 2: MountType:Permanent;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device. Agent must be installed as root.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux NFS Mount Point Custom Monitor - v5system_linux_nfs_mountpoint_utilizationSystem Linux NFS Mountpoint UtilizationPercentageMonitors the NFS Mount points utilization.
system_linux_nfs_mountpoint_accessibilitySystem Linux NFS Mountpoint Accessibility-Monitors the accessibility of NFS Mount points. An accessible NFS mount point typically means both read and write access(marked as "0" in output), and inaccessibility (marked as "1" in output) often means it's not writable.
system_linux_nfs_mountpoint_availabilitySystem Linux NFS Mountpoint Availability-Monitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state. If a mount point was present in the previous state but is not in the current state, it is marked as "1" (not available). If it is present in both states, it is marked as "0" (available).

Agent G2 - Linux NFS Mount Point Monitoring - v4

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization.In Version 4 of the template, we introduced enhanced functionality to monitor user-specific mounts accessibility. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points (i.e. only nfs mounts present in /etc/fstab).

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only (Case-Insensitive).

  • Format 1: All (This format monitors both temporary and permanent mount points)

  • Format 2: Permanent (This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device.

Supported Metric

Monitor NameMonitor DescriptionMetric NameMetric Display NameUnitMetric Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v4Monitors the Linux NFS mount points availability, accessibility, and utilizationsystem_linux_nfs_mountpoint_utilizationSystem Linux NFS Mountpoint UtilizationPercentageMonitors the NFS Mount points utilization.
system_linux_nfs_mountpoint_accessibilitySystem Linux NFS Mountpoint AccessibilityMonitors the accessibility of NFS Mount points.

An accessible NFS mount point typically means both read and write access(marked as “0” in output), and inaccessibility (marked as “1” in output) often means it’s not writable.

system_linux_nfs_mountpoint_availabilitySystem Linux NFS Mountpoint AvailabilityMonitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state.

If a mount point was present in the previous state but is not in the current state, it is marked as “1” (not available).

If it is present in both states, it is marked as “0” (available).

Agent G2 - Linux - NTP Monitoring Offset

Description

Monitoring delay in seconds

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - NTP Monitoring Offsetntp.offsetNtp OffsetNULLThe time difference between the local clock and the NTP reference clock

Agent G2 - Linux NTP Statistics

Description

Monitors the NTP offset and jitter values of only system peer (the remote NTP server marked with a * at the beginning) for Linux systems.

Prerequisites

NTP needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux NTP Statisticssystem_linux_NTP_offsetSystem Linux NTP OffsetmillisecondsMonitors the time offset between the system clock and the Network Time Protocol (NTP) reference, indicating how much the system clock is ahead or behind the NTP reference.
system_linux_NTP_jitterSystem Linux NTP JittermillisecondsMonitors the jitter in the Network Time Protocol (NTP) synchronization, which reflects the variability in timekeeping accuracy. It measures the short-term fluctuations in the time offset between the system clock and the NTP reference.

Agent G2 - Linux - Postfix Monitors

Description

Monitors postfix queues

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - Postfix Monitorspostfix.queues.deferredPostfix Queues DeferredNULLPostfix deferred mails queues count
postfix.queues.bouncePostfix Queues BounceNULLPostfix bounce mails queues count
postfix.queues.maildropPostfix Queues MaildropNULLPostfix maildrop mails queues count
postfix.queues.incomingPostfix Queues IncomingNULLPostfix incoming mail queues count
postfix.queues.activePostfix Queues ActiveNULLPostfix active mails queues count

Agent G2 - Linux Postfix Statistics

Description

Monitors the counts and sizes of specific mail queue types - namely, incoming, active, maildrop, deferred, and bounce queues.

Prerequisites:

Postfix needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux Postfix Statisticssystem_linux_postfix_active_mailqueue_sizeSystem Linux Postfix Active Mailqueue SizeBytesMonitors the size (in bytes) of active emails in the Postfix mail queue.
system_linux_postfix_deferred_mailqueue_sizeSystem Linux Postfix Deferred Mailqueue SizeBytes**Monitors the size (in bytes) of deferred emails in the Postfix mail queue.
system_linux_postfix_maildrop_mailqueue_sizeSystem Linux Postfix Maildrop Mailqueue SizeBytesMonitors the size (in bytes) of emails in the Postfix mail queue marked for maildrop.
system_linux_postfix_bounce_mailqueue_sizeSystem Linux Postfix Bounce Mailqueue SizeBytesMonitors the size (in bytes) of bounced emails in the Postfix mail queue.
system_linux_postfix_incoming_mailqueue_sizeSystem Linux Postfix Incoming Mailqueue SizeBytesMonitors the size (in bytes) of incoming emails in the Postfix mail queue.
system_linux_postfix_deferred_mailqueue_countSystem Linux Postfix Deferred Mailqueue CountCountMonitors the count of deferred emails in the Postfix mail queue.
system_linux_postfix_bounce_mailqueue_countSystem Linux Postfix Bounce Mailqueue CountCountMonitors the count of bounced emails in the Postfix mail queue.
system_linux_postfix_maildrop_mailqueue_countSystem Linux Postfix Maildrop Mailqueue CountCountMonitors the count of emails in the Postfix mail queue marked for maildrop.
system_linux_postfix_incoming_mailqueue_countSystem Linux Postfix Incoming Mailqueue CountCountMonitors the count of incoming emails in the Postfix mail queue.
system_linux_postfix_active_mailqueue_countsystem_linux_postfix_active_mailqueue_countCountMonitors the count of active emails in the Postfix mail queue.

Agent G2 - Linux - PostgresDB Aliveness Check Status

Description

To monitor Postgresql db_aliveness, Supported versions of PostgreSQL 11 or later (Validated this template on version PostgreSQL-11 and 12 versions).

Prerequisites

  • Agent installed on the target machine.
  • Create a Postgres environment file and provide the file path as input parameter while applying the template.
  • We need to provide env path for single instance - <env path> & for multiple instances - <env path1>, <env path2>,<env path3> Along with setting up postgres environment this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
  • Agent must have permission to access the provided .env file

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitorpostgres_check_dbalivePostgres Check DBAliveNULLTo monitor the aliveness of the postgres database

Agent G2 - Linux - PostgresDB Aliveness Check Status - v2

Description

To monitor the aliveness of the postgres database

Template Usage Guidelines:

  • Create a Postgres environment file and provide the file path as input parameter while applying the template.
  • We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
  • Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
  • Agent must have permission to access the provided .env file.
  • Sample pg_new_5432.env file data: export PATH=$PATH:/usr/pgsql-12/bin/ PGDATABASE=postgres PGPORT=5432 PGARCHIVEDIR=/var/lib/pgsql/backups_main/archive/ PGDATADIR=/var/lib/pgsql/12/data PGWALDIR=/var/lib/pgsql/12/data/pg_wal SERVICENAME=postgresql-12

Prerequisite

Agent must be installed on the target machine.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitor - v2postgres_check_dbalivePostgres Check DBAliveTo monitor the aliveness of the postgres database

Agent G2 - Linux PostgresDB Aliveness Check Status - v3

Description:

Monitors the PostgreSQL database aliveness status. The metric value is 1 if the PostgreSQL database is alive; otherwise, the value is 0.

Prerequisites:

  1. The Agent must be installed as Root on the target machine, with Agent version 14.0 or later.
  2. Create a PostgreSQL environment file and provide the file path as an input parameter when applying the template.
  3. For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.
  4. This env file should contain other parameters such as PGDATADIR, PGPORT, SERVICENAME, SERVICELEVEL, POSTGRESUSER, and POSTGRESPATH. The last three parameters (SERVICELEVEL, POSTGRESUSER, POSTGRESPATH) are necessary only for checking the status of PostgreSQL using pg_ctl; otherwise, they are optional.
  5. The agent must have execute permissions on the provided .env file.

The enhancements introduced in Version 3 (V3) of the script provide users with the flexibility to check the PostgreSQL aliveness status using either systemctl, pg_isready commands, or a combination of pg_isready and pg_ctl commands by giving respective parameters in env file as input.

Template Usage Guidelines: While assigning template on device, users need to pass specific input parameters -

For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.

Example:
Single Input Parameter:
/root/pg_new_5432.env

Multiple Input Parameters: /var/lib/pgsql/pg_new_5432.env,/var/lib/pgsql/pg_new_5433.env

  • Create a Postgres environment file and provide the file path as input parameter while applying the template.
  • We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
  • Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
  • Agent must have permission to access the provided .env file Example content of the .env file -

SampleContent while checking postgres status with pg_ctl command:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12           
SERVICELEVEL=pgctl          
POSTGRESUSER=postgres           
POSTGRESPATH=/usr/pgsql-12/bin/

SampleContent while checking postgres status without pg_ctl:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12           

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux PostgresDB Aliveness Check Status Monitor - v3postgres_check_dbalivePostgres Check DBAlive-To monitor the aliveness of the postgres database

Agent G2 - Linux OS Performance Monitoring - Advanced

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page outs & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux OS Resource Parameterssystem_linux_openFileDescriptors_UsedCountSystem Linux OpenFileDescriptors Used CountcountCurrent number of Open File Descriptors
system_linux_messageQueueIDs_UtilizationSystem Linux MessageQueueIDs Utilization%Used percentage of current message queue ID's
system_linux_Semaphores_UtilizationSystem Linux Semaphores Utilization%Semaphore arrays or sets used percentage
system_linux_loggedInUsers_PctSystem Linux Logged In Users Pct%Current number of logged in users percentage
system_linux_sharedMemoryIDs_UtilizationSystem Linux SharedMemoryIDs Utilization%Used percentage of shared memory ID's
system_linux_messageQueueIDs_UsedCountSystem Linux MessageQueueIDs Used CountcountCurrent number of message queue ID’s in use
system_linux_openFileDescriptors_UtilizationSystem Linux OpenFileDescriptors Utilization%Linux Open File Descriptors Used Percentage
system_linux_runningProcesses_PctSystem Linux Running Processes Pct%Current running processes percentage
system_linux_Semaphores_UsedCountSystem Linux Semaphores Used CountcountCurrent number of semaphore arrays in use
system_linux_sharedMemoryIDs_UsedCountSystem Linux SharedMemoryIDs Used CountcountCurrent number of shared memory ID’s in use
system_linux_loggedInUsers_CountSystem Linux LoggedInUsers CountcountCurrent number of logged in users
system_linux_runningProcesses_CountSystem Linux RunningProcesses CountcountCurrent number of running processes
Agent G2 - Linux Real Memory Statssystem_linux_RealMemory_PageOuts_KiloBytesPerSecSystem Linux Real Memory PageOuts KiloBytesPerSecKBpsMemory pages page out rate in Kilo Bytes per second.
system_linux_RealMemory_PageOuts_PagesPerSecSystem Linux Real Memory PageOuts PagesPerSecpsecMemory page out rate in pages per second.
system_linux_RealMemory_Scan_RateSystem Linux Real Memory Scan RatepsecNumber of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
Agent G2 - Linux Swap Memory Utilizationsystem_linux_swapMemory_UtilizationSystem Linux Swap Memory Utilization%Swap memory utilization in percent.
system_linux_individual_SwapArea_UtilizationSystem Linux Individual Swap Area Utilization%Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - V2

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page ins, page outs, swap in, swap out & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux OS Resource Parameterssystem_linux_openFileDescriptors_UsedCountSystem Linux OpenFileDescriptors Used CountcountCurrent number of Open File Descriptors
system_linux_messageQueueIDs_UtilizationSystem Linux MessageQueueIDs Utilization%Used percentage of current message queue ID's
system_linux_Semaphores_UtilizationSystem Linux Semaphores Utilization%Semaphore arrays or sets used percentage
system_linux_loggedInUsers_PctSystem Linux Logged In Users Pct%Current number of logged in users percentage
system_linux_sharedMemoryIDs_UtilizationSystem Linux SharedMemoryIDs Utilization%Used percentage of shared memory ID's
system_linux_messageQueueIDs_UsedCountSystem Linux MessageQueueIDs Used CountcountCurrent number of message queue ID’s in use
system_linux_openFileDescriptors_UtilizationSystem Linux OpenFileDescriptors Utilization%Linux Open File Descriptors Used Percentage
system_linux_runningProcesses_PctSystem Linux Running Processes Pct%Current running processes percentage
system_linux_Semaphores_UsedCountSystem Linux Semaphores Used CountcountCurrent number of semaphore arrays in use
system_linux_sharedMemoryIDs_UsedCountSystem Linux SharedMemoryIDs Used CountcountCurrent number of shared memory ID’s in use
system_linux_loggedInUsers_CountSystem Linux LoggedInUsers CountcountCurrent number of logged in users
system_linux_runningProcesses_CountSystem Linux RunningProcesses CountcountCurrent number of running processes
Agent G2 - Linux Real Memory Stats - V2system_linux_RealMemory_PageOuts_KiloBytesPerSecSystem Linux Real Memory PageOuts KiloBytesPerSecKBpsMemory pages page out rate in Kilo Bytes per second.
system_linux_RealMemory_PageOuts_PagesPerSecSystem Linux Real Memory PageOuts PagesPerSecpsecMemory page out rate in pages per second.
system_linux_RealMemory_Scan_RateSystem Linux Real Memory Scan RatepsecNumber of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
system_linux_RealMemory_SwapOuts_KiloBytesPerSecSystem Linux Real Memory SwapOuts KiloBytesPerSecKBpsSwap out rate in Kilo Bytes per second.
system_linux_RealMemory_PageIns_PagesPerSecSystem Linux Real Memory PageIns PagesPerSecpsecMemory pages page in rate in Pages per second.
system_linux_RealMemory_PageIns_KiloBytesPerSecSystem Linux Real Memory PageIns KiloBytesPerSecKBpsMemory pages page in rate in Kilo Bytes per second.
system_linux_RealMemory_SwapIns_KiloBytesPerSecSystem Linux Real Memory SwapIns KiloBytesPerSecKBpsSwap in rate in Kilo Bytes per second.
Agent G2 - Linux Swap Memory Utilizationsystem_linux_swapMemory_UtilizationSystem Linux Swap Memory Utilization%Swap memory utilization in percent.
system_linux_individual_SwapArea_UtilizationSystem Linux Individual Swap Area Utilization%Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - v3

Description:

Monitors the data related to OS resource parameters like Open FDs,Logge In users, Context Switches, Processes created, Running processes, Page Faults, Semaphores, Shared Memory IDs,Message queue IDs, TCP Connection states, Swap memory, Real memory Statistics and disk statistics. Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.
Note: When the server is rebooted or when the disk counter’s valid range is exceeded, negative values for disk metrics will occur, as we are calculating rates.

Prerequisites

Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux Swap Memory Utilizationsystem_linux_swapMemory_UtilizationSystem Linux Swap Memory Utilization%Swap memory utilization in percent.
system_linux_individual_SwapArea_UtilizationSystem Linux Individual Swap Area Utilization%Individual swap area utilization in percent.
Agent G2 - Linux Real Memory Stats - V2system_linux_RealMemory_Scan_RateSystem Linux Real Memory Scan RatepsecNumber of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file). Prerequisite: sysstat package should be installed and sar -B command should respond
system_linux_RealMemory_PageOuts_PagesPerSecSystem Linux Real Memory PageOuts PagesPerSecpsecMemory page out rate in pages per second.
system_linux_RealMemory_PageOuts_KiloBytesPerSecSystem Linux Real Memory PageOuts KiloBytesPerSecKBpsMemory pages page out rate in Kilo Bytes per second.
system_linux_RealMemory_PageIns_KiloBytesPerSecSystem Linux Real Memory PageIns KiloBytesPerSecKBpsMemory pages page in rate in Kilo Bytes per second.
system_linux_RealMemory_PageIns_PagesPerSecSystem Linux Real Memory PageIns PagesPerSecpsecMemory pages page in rate in Pages per second.
system_linux_RealMemory_SwapIns_KiloBytesPerSecSystem Linux Real Memory SwapIns KiloBytesPerSecKBpsSwap in rate in Kilo Bytes per second.
system_linux_RealMemory_SwapOuts_KiloBytesPerSecSystem Linux Real Memory SwapOuts KiloBytesPerSecKBpsSwap out rate in Kilo Bytes per second.
Agent G2 - Linux TCP Connection States Monitorsystem_linux_tcp_connection_statesSystem Linux TCP Connection StatescountMonitors the count of TCP connections in various states on the Linux system.
Agent G2 - Linux Disk Statisticssystem_linux_disk_IOQueueLengthSystem Linux Disk IOQueueLengthnullMonitors the length of the I/O queue for disk operations.
system_linux_disk_averageLatencySystem Linux Disk AverageLatencymicrosecMonitors the average response time of the disk subsystem to process I/O requests.
system_linux_disk_averageReadRequestSizeSystem Linux Disk AverageReadRequestSizeKBMonitors the average size of read requests issued to the disk.
system_linux_disk_averageRequestSizeSystem Linux Disk AverageRequestSizeKBMonitors the average size of all read and write requests issued to the disk.
system_linux_disk_averageWriteRequestSizeSystem Linux Disk AverageWriteRequestSizeKBMonitors the average size of write requests issued to the disk.
system_linux_disk_timeUtilizationSystem Linux Disk TimeUtilization%Monitors the utilization of the disk, measured as the percentage of time the disk is actively processing I/O operations.
system_linux_disk_readOperationsRateSystem Linux Disk ReadOperationsRateMonitors the rate of read operations issued to the disk per second.psec
system_linux_disk_readThroughputSystem Linux Disk ReadThroughputKBpsMonitors the rate of data read from the disk per second.
system_linux_disk_averageReadWaitTimeSystem Linux Disk AverageReadWaitTimemicrosecMonitors the average wait time for read requests.
system_linux_disk_averageRequestWaitTimeSystem Linux Disk AverageRequestWaitTimemicrosecMonitors the time a disk operation (read and write) waits in the I/O queue before being processed.
system_linux_disk_writeOperationsRateSystem Linux Disk WriteOperationsRatepsecMonitors the rate of write operations issued to the disk per second.
system_linux_disk_writeThroughputSystem Linux Disk WriteThroughputKBpsMonitors the rate of data written to the disk per second.
system_linux_disk_averageWriteWaitTimeSystem Linux Disk AverageWriteWaitTimemicrosecMonitors the average wait time for write requests.
Agent G2 - Linux OS Resource Parameters - v2system_linux_openFileDescriptors_UtilizationSystem Linux OpenFileDescriptors Utilization%Linux Open File Descriptors Used Percentage
system_linux_openFileDescriptors_UsedCountSystem Linux OpenFileDescriptors Used CountcountCurrent number of Open File Descriptors
system_linux_loggedInUsers_PctSystem Linux Logged In Users Pct%Current number of logged in users percentage
system_linux_loggedInUsers_CountSystem Linux LoggedInUsers CountcountCurrent number of logged in users
system_linux_runningProcesses_PctSystem Linux Running Processes Pct%Current running processes percentage
system_linux_runningProcesses_CountSystem Linux RunningProcesses CountcountCurrent number of running processes
system_linux_Semaphores_UtilizationSystem Linux Semaphores Utilization%Semaphore arrays or sets used percentage
system_linux_Semaphores_UsedCountSystem Linux Semaphores Used CountcountCurrent number of semaphore arrays in use
system_linux_messageQueueIDs_UtilizationSystem Linux MessageQueueIDs Utilization%Used percentage of current message queue ID's
system_linux_messageQueueIDs_UsedCountSystem Linux MessageQueueIDs Used CountcountCurrent number of message queue ID?s in use
system_linux_sharedMemoryIDs_UtilizationSystem Linux SharedMemoryIDs Utilization%Used percentage of shared memory ID's
system_linux_sharedMemoryIDs_UsedCountSystem Linux SharedMemoryIDs Used CountcountCurrent number of shared memory ID?s in use
system_linux_createdProcessesPerSecSystem Linux CreatedProcesses PerSecCount per secProvides the count of processes created or managed per second on the Linux system since the system was rebooted.
system_linux_pageFaultsPerSecSystem Linux PageFaults PerSecCount per secMonitors the count of page faults per second on the Linux system.
system_linux_kernelContextSwitchesPerSecSystem Linux KernelContextSwitches PerSecCount per secMonitors the count of context switches per second on the Linux system.

Agent G2 - Linux Services Monitoring

Description

Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only.

  • Format 1: all (case-insensitive) If “all” is specified as custom script arguments, the script monitors all available services along with alert tokens, that provide additional information, including the total count of services and the count of services in each available state.

  • Format 2: tuned,opsramp.*, systemd (provide service names without .service extension as shown here) Users can specify comma-separated service names or service regex patterns for a more focused monitoring approach. The script filters and retrieves status information about the mentioned services only.

Note: We strongly recommend specifying only particular service names in input parameters,(that is Format 2) as monitoring all services may significantly increase the system load, especially in environments with a large number of services.

Prerequisites

This template only works on systems having Systemd as the default init system.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Linux Services Monitorsystem_linux_services_statusSystem Linux Services Status-Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Agent G2 - Microsoft Windows IIS App Pool State

Description

Monitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column ‘Name’. By default, it will monitor all the available App Pools because the default value is ‘all’ Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Microsoft Windows IIS App Pool Statemicrosoft_windows_iis_appPool_stateMicrosoft Windows IIS App Pool StateStateMonitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column 'Name'. By default, it will monitor all the available App Pools because the default value is 'all.' Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No prerequisite

Supported Metric

Monitor NameMonitor DescriptionMetric NameMetric Display NameUnitDescription
Agent G2 - Microsoft AD DNS Server Bind TimeMonitors network connectivity test to the specified DNS server IP's.
Example: 127.0.0.1 127.0.0.3
microsoft_AD_DNS_server_bindTimeMicrosoft AD DNS Server BindTimemsMonitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind TimeMonitors Active Directory Global Catalog Bind Time in Milliseconds. User need to provide AD Domain Controller IP along with its port with : separated.
Example: 127.0.0.1:3268
microsoft_AD_global_catalog_bindTimeMicrosoft AD Global Catalog BindTimemsMonitors Microsoft Active Directory Global Catalog Bind Time in milliseconds.
Agent G2 - Microsoft AD Global Catalog Search TimeMonitors Active Directory Global catalog search time in milliseconds using given Domain Controller IPS's and its associated filter. It measures the time it takes to perform the search operation. User need to provide Domain Controller IP:port and LDAP Filter Name.
Example: DomainControllerIP_and_Port: 127.0.0.1:3268 AD_LDAP_Filter: organization
microsoft_AD_global_catalog_searchTimeMicrosoft AD Global Catalog SearchTimemsMonitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailabilityMonitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.microsoft_AD_lost_object_countMicrosoft AD Lost Object CountcountMonitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailabilityMonitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.microsoft_AD_SYSVOL_share_availabilityMicrosoft AD SYSVOL Share AvailabilitynullMonitors Microsoft Active Directory SYSVOL share is available or not.

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability - v2

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No Prerequisites

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Microsoft AD DNS Server Bind Timemicrosoft_AD_DNS_server_bindTimeMicrosoft AD DNS Server BindTimemsMonitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind Timemicrosoft_AD_global_catalog_bindTimeMicrosoft AD Global Catalog BindTimemsMonitors Microsoft Active Directory Global Catalog Bind Time in milliseconds
Agent G2 - Microsoft AD Global Catalog Search Timemicrosoft_AD_global_catalog_searchTimeMicrosoft AD Global Catalog SearchTimemsMonitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailabilitymicrosoft_AD_lost_object_countMicrosoft AD Lost Object CountcountMonitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailabilitymicrosoft_AD_SYSVOL_share_availabilityMicrosoft AD SYSVOL Share AvailabilitynullMonitors Microsoft Active Directory SYSVOL share is available or not.
Agent G2 - Microsoft AD BindTimemicrosoft_AD_bindTimeMicrosoft AD BindTimemsMonitors Active Directory BindTime for Domain Controller, Infrastructure Master, Domain Naming Master, Primary Domain Controller Emulator (PDC), Relative ID master (RID), Schema Master (SCH) in milliseconds.
Agent G2 - Microsoft AD LastSuccessful Synchronization Timemicrosoft_AD_lastSuccessfulSyncTimeMicrosoft AD LastSuccessfulSync TimemMonitors Microsoft Active Directory last successful synchronization time in minutes.

Agent G2 - Microsoft Windows OS Counters - RSE - v3

Description

To Monitor OS related counters like disk, memory. In this version, added these additonal metrics support: system_windows_Memory_TotalInstalledRAM,system_windows_Memory_UsedRAM,system_windows_Memory_CommitCharge,system_windows_Memory_PageFileInstalled

Prerequisites

No Prerequisites

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
System Windows LogicalDisk Monitorsystem_windows_logicaldisk_UsedSpaceInMegaBytesSystem Windows LogicalDisk UsedSpace In MegaBytesMBTotal usable space on the selected logical disk drive that was free in MB
system_windows_logicaldisk_DiskReadPerSecondSystem Windows LogicalDisk DiskRead PerSecondropsDisk Reads/sec is the rate of read operations on the disk.
system_windows_logicaldisk_AvgDiskSecPerReadSystem Windows LogicalDisk AvgDiskSec PerReadnullAvg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
system_windows_logicaldisk_AvgDiskQueueLengthSystem Windows LogicalDisk AvgDiskQueueLengthnullAvg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
system_windows_logicaldisk_FreeSpaceInPercentSystem Windows LogicalDisk FreeSpace In Percent%% Free Space is the percentage of total usable space on the selected logical disk drive that was free.
system_windows_logicaldisk_FreeSpaceInMBSystem Windows LogicalDisk FreeSpace InMBMBFree Megabytes displays the unallocated space, in megabytes, on the disk drive in megabytes. One megabyte is equal to 1,048,576 bytes.
system_windows_logicaldisk_DiskWriteBytesPerSecondSystem Windows Logicaldisk DiskWriteBytes PerSecondBpsDisk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
system_windows_logicaldisk_DiskWritePerSecondSystem windows LogicalDisk DiskWrite PerSecondwopsDisk Writes/sec is the rate of write operations on the disk.
system_windows_logicaldisk_DiskReadBytesPerSecondSystem Windows LogicalDisk DiskReadBytes PerSecondBpsDisk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
system_windows_logicaldisk_AvgDiskSecPerWriteSystem Windows LogicalDisk AvgDiskSec PerWritenullAvg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
System Windows Processor Monitormicrosoft_windows_Processor_PercentPrivilegedTimeMicrosoft Windows Processor PercentPrivilegedTime%% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
system_windows_processorDPCrateSystem Windows Processor DPCratenullDPC Rate is the rate at which deferred procedure calls (DPCs) were added to the processors DPC queues between the timer ticks of the processor clock. DPCs are interrupts that run at alower priority than standard interrupts. Each processor has its own DPC queue. This counter measures the rate that DPCs were added to the queue, not the number of DPCs in the queue. This counter displays the last observed value only; it is not an average.
system_windows_processor_percentprocessortimeSystem Windows Processor PercentProcessorTime%% Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the percentage of time that the processor spends executing the idle thread and then subtracting that value from 100%. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It should be noted that the accounting calculation of whether the processor is idle is performed at an internal sampling interval of the system clock (10ms). On todays fast processors, % Processor Time can therefore underestimate the processor utilization as the processor may be spending a lot of time servicing threads between the system clock sampling interval. Workload based timer applications are one example of applications which are more likely to be measured inaccurately as timers are signaled just after the sample is taken.
system_windows_processorInterruptsPerSecSystem Windows ProcessorInterrupts PerSecpsecInterrupts/sec is the average rate, in incidents per second, at which the processor received and serviced hardware interrupts. It does not include deferred procedure calls (DPCs), which are counted separately. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards, and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended. The system clock typically interrupts the processor every 10 milliseconds, creating a background of interrupt activity. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.
microsoft_windows_ProcessorInformation_PercentC1TimeMicrosoft Windows ProcessorInformation PercentC1Time%% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running state. Not all systems support the % C1 state
microsoft_windows_ASP_InMemoryTemplatesCachedMicrosoft Windows ASP InMemoryTemplatesCachedcountThe number of compiled templates cached in memory.
System Windows PhysicalDisk Monitorsystem_windows_PhysicalDisk_writesPerSecSystem Windows PhysicalDisk Writes PerSecpsecDisk Writes/sec is the rate of write operations on the disk.
system_windows_PhysicalDisk_avgDiskSecPerReadSystem Windows PhysicalDisk AvgDiskSec PerReadnullAvg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
system_windows_PhysicalDisk_writeBytesPerSecSystem Windows PhysicalDisk WriteBytes PerSecBpsDisk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
System_Windows_PhysicalDisk_readBytesPerSecSystem Windows PhysicalDisk ReadBytes PerSecBpsDisk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
System_Windows_PhysicalDisk_avgDiskSecPerWriteSystem Windows PhysicalDisk AvgDiskSec PerWritenullAvg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
system_windows_PhysicalDisk_readsPerSecSystem Windows PhysicalDisk ReadsPerSecpsecDisk Reads/sec is the rate of read operations on the disk.
System_Windows_PhysicalDisk_avgDiskQueueLengthSystem Windows PhysicalDisk avgDiskQueueLengthnullAvg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
microsoft_windows_PhysicalDisk_AvgDiskBytesPerReadMicrosoft Windows PhysicalDisk AvgDiskBytesPerReadnullAvg. Disk Bytes/Read is the average number of bytes transferred from the disk during read operations.
microsoft_windows_PagingFile_PercentUsageMicrosoft Windows PagingFile PercentUsage%The amount of the Page File instance in use in percent
System Windows Server Monitorsystem_windows_server_logonsPerSecSystem Windows Server LogonsPerSecpsecLogon/sec is the rate of all server logons.
system_windows_contextSwitchesPerSecSystem Windows ContextSwitchesPerSecpsec"Context Switches/sec is the combined rate at which all processors on the computer are switched from one thread to another. Context switches occur when a running thread voluntarily relinquishes the processor, is preempted by a higher priority ready thread, or switches between user-mode and privileged (kernel) mode to use an Executive or subsystem service. It is the sum of Thread Context Switches/sec for all threads running on all processors in the computer and is measured in numbers of switches. There are context switch counters on the System and Thread objects. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval."
system_windows_bytesTransmittedPerSecSystem Windows BytesTransmitted PerSecpsecThe number of bytes the server has sent on the network. Indicates how busy the server is.
microsoft_windows_System_ProcessorQueueLengthMicrosoft Windows System ProcessorQueueLengthnullProcessor Queue Length is the number of threads in the processor queue. Unlike the disk counters, this counter counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than 10 threads per processor is normally acceptable, dependent of the workload.
system_windows_bytesReceivedPerSecSystem Windows BytesReceived PerSecpsecThe number of bytes the server has received from the network. Indicates how busy the server is.
Agent G2 - Windows Memory Custom Monitor - v3System_Windows_Pages_Output_PerSecSystem_Windows_Pages_Output_PerSecpsec
System_Windows_Memory_AvailableMbytesSystem_Windows_Memory_AvailableMbytesMBCalculates the Memory Available in Mega Bytes of the System
System_Windows_Memory_CommitLimitSystem_Windows_Memory_CommitLimitBytesCalculates the physical memory space reserved on the disk paging files
System_Windows_Memory_CommittedBytesSystem_Windows_Memory_CommittedBytesBytesCalculates the Total Number of Committed Bytes of the System
System_Windows_Memory_CommittedBytes_InuseSystem_Windows_Memory_CommittedBytes_InuseBytesCalculates the Percentage of the Committed Bytes In use of the System
System_Windows_Memory_PageFaults_PerSecSystem_Windows_Memory_PageFaults_PerSecpsecCalculates the Total Number of Memory Page Faults Per Second of the System
System_Windows_Memory_Pages_PerSecSystem_Windows_Memory_Pages_PerSecpsecCalculates the Total Number of Memory pages per second of the System
system_windows_rawdata_pagesIn_PerSecondsystem_windows_rawdata_pagesIn_PerSecondnull
system_windows_Memory_TotalInstalledRAMSystem Windows Memory TotalInstalledRAMGBTotal PhysicalMemory(RAM) in GB
system_windows_Memory_UsedRAMSystem Windows Memory UsedRAMGBUsed PhysicalMemory(RAM) in GB
system_windows_Memory_CommitChargeSystem Windows Memory CommitChargeGBCommit Charge is the amount of committed virtual memory. Committed memory is the physical memory which has space reserved on the disk paging file(s). There can be one or more paging files on each physical drive. This counter displays the last observed value only; it is not an average.
system_windows_Memory_PageFileInstalledSystem Windows Memory PageFileInstalledGBPage File Installed(Commit Limit) is the amount of virtual memory that can be committed without having to extend the paging file(s). Committed memory is the physical memory which has space reserved on the disk paging files. There can be one paging file on each logical drive). If the paging file(s) are be expanded, this limit increases accordingly. This counter displays the last observed value only; it is not an average.

Agent G2 - Microsoft Windows OS Counters - RSE - v2

Description

To Monitor OS related counters like disk,memory

Prerequisites

No Prerequisites

Agent G2 - MSSQL Database Availability Status - v2

Description

Monitors MSSQL Instance Connection Time in milliseconds and Database Instance status along with Database Status. If the Instance is in a running state and the Databases associated with the instance is offline, it considers the Instance as Down. Conversely, if the Instance is in a running state and the associated Database is up, it considers the Instance as Up. Default value is ‘all’ i.e., it will monitor all databases. If user need to monitor any particular databases, then provide the database names with comma separated. Example: master,msdb,temp.

Prerequisites

Agent G2 - MSSQL Database Availability Status - v2

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - MSSQL Database Availability Status - v2mssql_database_availability_statusMSSQL Database Availability StatusStatusMSSQL Database Availability Status
mssql_database_connection_timeMSSQL Database Connection TimemsMonitors MSSQL Database Instance Connection Time in milliseconds

Agent G2 - MSSQL Database Data and Log Files Freespace and Utilization

Description

Monitors MSSQL Database Log & Data file Freespace and utilization.

Prerequisites

Requires Agent version 14.0.0 or later. MSSQL database credentials must be added to the device. When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Template Usage Guidelines:

  • Requires Agent version 14.0.0 or later.
  • MSSQL database credentials must be added to the device.
  • When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.
IBM-AIX

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - MSSQL Database Data and Log Files Freespace and Utilizationmssql_database_logFilesFreeSpaceMSSQL Database LogFileFreeSpace%Monitors MSSQL database LogFiles free space
mssql_database_dataFilesFreeSpaceMSSQL Database DataFilesFreeSpace%Monitors MSSQL datafiles free space regardless of auto-growth
mssql_database_ldf_file_utilization_percentageMSSQL Database ldf File Utilization in Percentage%Monitors MSSQL .ldf files utilization in percentage
mssql_database_ndf_file_utilization_percentageMSSQL Database ndf File Utilization Percentage%Monitors MSSQL .ndf files utilization in percentage
mssql_database_mdf_file_utilization_percentageMSSQL Database mdf File Utilization Percentage%Monitors MSSQL .mdf files utilization in percentage

Agent G2 - MSSQL Database Agent Job Status

Description

Monitors MSSQL Agent Job Status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress.

Prerequisites

Requires Agent version 14.0.0 or later. MSSQL database credentials must be added to the device. When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Template Usage Guidelines:

  • Requires Agent version 14.0.0 or later.
  • MSSQL database credentials must be added to the device.
  • When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.
IBM-AIX

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - MSSQL Database Agent Job Statusmssql_database_agentJobStatusMSSQL Database AgentJobStatusMSSQL DB Agent Jobs Status : This metric collects mssql agent job status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress

Agent G2 - Microsoft Windows MSSQL Performance and Statistics

Description:

Monitors the various performance statistics of MSSQL from versions 2000 to 2022. Ensure that required WMI classes be available in system.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters specifying version of MSSQL. The default value is set to “MSSQL2022.”

Example 1: MSSQL2022

This monitors the MSSQL 2022 statistics for given metrics.

Example 2: MSSQL2019

This monitors the MSSQL 2019 statistics for given metrics.

Below are the Namespaces associated to MSSQL version.

“MSSQL2000” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2005” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2008” namespace = “root\Microsoft\SqlServer\ComputerManagement10” “MSSQL2012” namespace = “root\Microsoft\SqlServer\ComputerManagement11” “MSSQL2014” namespace = “root\Microsoft\SqlServer\ComputerManagement12” “MSSQL2016” namespace = “root\Microsoft\SqlServer\ComputerManagement13” “MSSQL2017” namespace = “root\Microsoft\SqlServer\ComputerManagement14” “MSSQL2019” namespace = “root\Microsoft\SqlServer\ComputerManagement15” “MSSQL2022” namespace = “root\Microsoft\SqlServer\ComputerManagement16”

To validate which namespaces exist on the device and provide the correct MSSQL version:

  1. Click Start and search for computer management.
  2. Under Services and Application, select WMI Control.
  3. Right click services and select security tab Namespace: root\Microsoft\SqlServer?
    Please find the attached screenshot for your reference.

Prerequisites

Ensure that required WMI classes be available in system.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Microsoft Windows MSSQL Performance and Statisticsmicrosoft_windows_MSSQL_latchWaitsPerSecMicrosoft Windows MSSQL LatchWaits PerSecCount per secMonitors the number of latch requests that could not be granted immediately and had to wait before being granted.
microsoft_windows_MSSQL_averageLatchWaitTimemsMicrosoft Windows MSSQL AverageLatchWaitTimemsmsMonitors the average latch wait time (milliseconds) for latch requests that had to wait.
microsoft_windows_MSSQL_dataFilesSizeKBMicrosoft Windows MSSQL DataFilesSizeKBKBMonitors the cumulative size of all the data files in the database.
microsoft_windows_MSSQL_logFilesUsedSizeKBMicrosoft Windows MSSQL LogFilesUsedSizeKBKBMonitors the cumulative used size of all the log files in the database.
microsoft_windows_MSSQL_logFlushesPersecMicrosoft Windows MSSQL LogFlushesPersecCount per secMonitors the total number of log flushes.
microsoft_windows_MSSQL_transactionsPersecMicrosoft Windows MSSQL TransactionsPersecCount per secMonitors the total number of transactions started for the database
microsoft_windows_MSSQL_lockTimeoutsPersecMicrosoft Windows MSSQL LockTimeoutsPersecCount per secMonitors the number of lock requests that timed out. This includes requests for NOWAIT locks.
microsoft_windows_MSSQL_numberofDeadlocksPersecMicrosoft Windows MSSQL NumberofDeadlocksPersecCount per secMonitors the number of lock requests that resulted in a deadlock.
microsoft_windows_MSSQL_averageWaitTimemsMicrosoft Windows MSSQL AverageWaitTimemsmsMonitors the total average amount of wait time (milliseconds) for each lock request that resulted in a wait.
microsoft_windows_MSSQL_lockWaitsPersecMicrosoft Windows MSSQL LockWaitsPersecCount per secMonitors the total number of lock requests that could not be satisfied immediately and required the caller to wait before being granted the lock.
microsoft_windows_MSSQL_pagelifeexpectancyMicrosoft Windows MSSQL PagelifeexpectancysMonitors the number of seconds a page will stay in the buffer pool without references
microsoft_windows_MSSQL_lazywritesPersecMicrosoft Windows MSSQL LazywritesPersecCount per secMonitors the number of buffers written by buffer manager's lazy writer.
microsoft_windows_MSSQL_pagereadsPersecMicrosoft Windows MSSQL PagereadsPersecCount per secMonitors the number of physical database page reads issued.
microsoft_windows_MSSQL_pagewritesPersecMicrosoft Windows MSSQL PagewritesPersecCount per secMonitors the number of physical database page writes issued.
microsoft_windows_MSSQL_checkpointpagesPersecMicrosoft Windows MSSQL CheckpointpagesPersecCount per secMonitors the number of pages flushed by checkpoint or other operations that require all dirty pages to be flushed.
microsoft_windows_MSSQL_connectionMemoryKBMicrosoft Windows MSSQL ConnectionMemoryKBKBMonitors the total amount of dynamic memory the server is using for maintaining connections.
microsoft_windows_MSSQL_databaseCacheMemoryKBMicrosoft Windows MSSQL DatabaseCacheMemoryKBKBMonitors the amount of memory the server is currently using for the database cache.
microsoft_windows_MSSQL_freeMemoryKBMicrosoft Windows MSSQL FreeMemoryKBKBMonitors the amount of memory the server is currently not using.
microsoft_windows_MSSQL_lockMemoryKBMicrosoft Windows MSSQL LockMemoryKBKBMonitors the total amount of dynamic memory the server is using for locks.
microsoft_windows_MSSQL_memoryGrantsPendingMicrosoft Windows MSSQL MemoryGrantsPendingcountMonitors the current number of processes waiting for a workspace memory grant.
microsoft_windows_MSSQL_optimizerMemoryKBMicrosoft Windows MSSQL OptimizerMemoryKBKBMonitors the total amount of dynamic memory the server is using for query optimization.
microsoft_windows_MSSQL_totalServerMemoryKBMicrosoft Windows MSSQL TotalServerMemoryKBKBMonitors the total amount of dynamic memory the server is currently consuming.
microsoft_windows_MSSQL_SQLCacheMemoryKBMicrosoft Windows MSSQL SQLCacheMemoryKBKBMonitors the total amount of dynamic memory the server is using for the dynamic SQL cache.
microsoft_windows_MSSQL_forwardedRecordsPersecMicrosoft Windows MSSQL ForwardedRecordsPersecCount per secMonitors the number of records fetched through forwarded record pointers.
microsoft_windows_MSSQL_pageSplitsPersecMicrosoft Windows MSSQL PageSplitsPersecCount per secMonitors the number of page splits per second that occur as a result of overflowing index pages.
microsoft_windows_MSSQL_fullScansPersecMicrosoft Windows MSSQL FullScansPersecCount per secMonitors the number of unrestricted full scans. These can either be base table or full index scans.
microsoft_windows_MSSQL_processesBlockedMicrosoft Windows MSSQL ProcessesBlockedcountMonitors the Number of currently blocked processes.
microsoft_windows_MSSQL_userConnectionsMicrosoft Windows MSSQL UserConnectionscountMonitors the number of users connected to the system.
microsoft_windows_MSSQL_loginsPersecMicrosoft Windows MSSQL LoginsPersecCount per secMonitors the total number of logins started per second.
microsoft_windows_MSSQL_logoutsPersecMicrosoft Windows MSSQL LogoutsPersecCount per secMonitors the total number of logouts started per second.
microsoft_windows_MSSQL_longestTransactionRunningTimeMicrosoft Windows MSSQL LongestTransactionRunningTimesMonitors the longest running time of any transaction in seconds.
microsoft_windows_MSSQL_receiveIPerOsPersecMicrosoft Windows MSSQL ReceiveIPerOsPersecCount per secMonitors the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment
microsoft_windows_MSSQL_sendIPerOsPersecMicrosoft Windows MSSQL SendIPerOsPersecCount per secMonitors the number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
microsoft_windows_MSSQL_openConnectionCountMicrosoft Windows MSSQL OpenConnectionCountCountMonitors the total number of transport connections currently open.
microsoft_windows_MSSQL_SQLCompilationsPersecMicrosoft Windows MSSQL SQLCompilationsPersecCount per secMonitors the number of SQL compilations.
microsoft_windows_MSSQL_SQLReCompilationsPersecMicrosoft Windows MSSQL SQLReCompilationsPersecCount per secMonitors the number of SQL re-compiles.
microsoft_windows_MSSQL_batchRequestsPersecMicrosoft Windows MSSQL BatchRequestsPersecCount per secMonitors the number of SQL batch requests received by server.
microsoft_windows_MSSQL_taskLimitReachedMicrosoft Windows MSSQL TaskLimitReachedcountMonitors the total number of times the activated task limit on a queue has been reached.
microsoft_windows_MSSQL_tasksAbortedPersecMicrosoft Windows MSSQL TasksAbortedPersecCount per secMonitors the number of activated tasks that are being aborted per second.
microsoft_windows_MSSQL_SQLRECEIVEsPersecMicrosoft Windows MSSQL SQLRECEIVEsPersecCount per secMonitors the number of SQL RECEIVE commands processed by the Broker per second.
microsoft_windows_MSSQL_BrokerTransactionRollbacksMicrosoft Windows MSSQL BrokerTransactionRollbackscountMonitors the number of Service Broker related transactions that have rolled back.
microsoft_windows_MSSQL_SQLSENDsPersecMicrosoft Windows MSSQL SQLSENDsPersecCount per secMonitors the number of SQL SEND commands processed by the Broker per second.
microsoft_windows_MSSQL_logBytesFlushedPersecMicrosoft Windows MSSQL LogBytesFlushedPersecBpsMonitors the total number of log bytes flushed.
microsoft_windows_MSSQL_percentLogUsedMicrosoft Windows MSSQL PercentLogUsed%Monitors the percent of space in the log that is in use.
microsoft_windows_MSSQL_logFilesSizeKBMicrosoft Windows MSSQL LogFilesSizeKBKBMonitors the cumulative size of all the log files in the database.
microsoft_windows_MSSQL_logFlushWaitsPersecMicrosoft Windows MSSQL LogFlushWaitsPersecCount per secMonitors the number of commits waiting on log flush.
microsoft_windows_MSSQL_logGrowthsMicrosoft Windows MSSQL LogGrowthscountMonitors the total number of log growths for this database.
microsoft_windows_MSSQL_logShrinksMicrosoft Windows MSSQL LogShrinkscountMonitors the total number of log shrinks for this database.
microsoft_windows_MSSQL_cacheHitRatioPercentageMicrosoft Windows MSSQL CacheHitRatio Percentage%Monitors the percentage of cache hits relative to cache lookups.
microsoft_windows_MSSQL_bufferCacheHitRatioPercentageMicrosoft Windows MSSQL Buffercachehitratio Percentage%Monitors the percentage of pages that were found in the buffer pool without having to incur a read from disk.

Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as component

Description

To monitor certificate(s) expiry (in days) which are available in Certificate Manager and not yet expired. This template contains “Issued To and Serial Number” in alert subject.

Template Usage Guidelines:

The script receives its parameters from custom monitor during Runtime.

Params field in the custom monitor holds the certificate store path, the excluded Thumbprints OR the keyword “all”

Formulate your Path params in the format specified below and encode the string. The string has two parts to it separated by a semicolon ( ; ).

The Certificate Store paths are separated by a comma (,) and are present to the left to the semicolon separator.

The list of Thumbprints that needs to be excluded from the monitor are comma (,) separated and are present to the right of the semicolon separator.

The error or warning alerts contains Certificate information specifying respective certificate’s Issuer, Subject, Serial Number.

Case 1: Giving input as specific paths and excluding few certificates from those paths(using their thumbprints)

Example String Before Encoding:

cert:\LocalMachine\Root, cert:\LocalMachine\AuthRoot;a8985d3a65e5e5c4b2d7d66d40c6dd2fb19c5436,df3c24f9bfd666761b268073fe06d1cc8d4f82a4

Example String After Encoding: (use a tool like notepad++ or online resource like https://www.base64encode.org/ to encode your params string)

Y2VydDpcTG9jYWxNYWNoaW5lXFJvb3QsY2VydDpcTG9jYWxNYWNoaW5lXEF1dGhSb290O+KAjmE4OTg1ZDNhNjVlNWU1YzRiMmQ3ZDY2ZDQwYzZkZDJmYjE5YzU0MzYs4oCOZGYzYzI0ZjliZmQ2NjY3NjFiMjY4MDczZmUwNmQxY2M4ZDRmODJhNA==

Case 2: Monitoring all the certificates from all folders or Current User account and Local Machine account

To monitor all the certificates user needs to give input as “all”

Prerequisite

Powershell Version 3 and above.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as componentwindows_certStore_certificatesExpiryInDaysWindows CertStore CertificatesExpiry InDaysDaysTo monitor certificate(s) expiry (in days) which are available in Certificate Manager.

Agent G2 - Windows Memory Monitoring

Description

Agent G2 - Windows Service Monitoring v2.0

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Memory Custom Monitorsystem.windows.memory.availableSystem Windows Memory AvailableMBAvailable MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.

Agent G2 - Windows Network Interface Monitoring

Description

Agent G2 - Windows Network Interface Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Network Interface Custom Monitorsystem.windows.network.interface.packets.persecSystem Windows Network Interface Packets Per Secpackets/secPackets/sec is the rate at which packets are sent and received on the network interface.
system.windows.network.interface.traffic.inSystem Windows Network Interface Traffic InbpsBytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.traffic.outSystem Windows Network Interface Traffic OutbpsBytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.traffic.totalSystem Windows Network Interface Traffic TotalbpsBytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows Network Interface Monitoring - v3

Description

Monitors Windows Network Interface metrics. In this version of template, we have added support for new metrics, and we have also modified the metric names from the existing dotted notation to underscore format.

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Network Interface Custom Monitor - v3system_windows_network_interface_statusSystem Windows Network Interface StatusnullNetConnectionStatus is a string indicating the state of the network adapter's connection to the network. The value of the property is to be interpreted as follows: 0 - Disconnected 1 - Connecting 2 - Connected 3 - Disconnecting 4 - Hardware not present 5 - Hardware disabled 6 - Hardware malfunction 7 - Media disconnected 8 - Authenticating 9 - Authentication succeeded 10 - Authentication failed 11 - Invalid Address 12 - Credentials Required Other (13?65535)
system_windows_network_interface_currentBandwidthSystem Windows Network Interface CurrentBandwidthbpsCurrent Bandwidth is an estimate of the current bandwidth of the network interface in bits per second (BPS). For interfaces that do not vary in bandwidth or for those where no accurate estimation can be made, this value is the nominal bandwidth.
system_windows_network_interface_packetsReceivedPersecSystem Windows Network Interface PacketsReceivedPersecpsecPackets Received/sec is the rate at which packets are received on the network interface.
system_windows_network_interface_packetsSentPersecSystem Windows Network Interface PacketsSentPersecpsecPackets Sent/sec is the rate at which packets are sent on the network interface.
system_windows_network_interface_packetsReceivedNonUnicastPersecSystem Windows Network Interface PacketsReceivedNonUnicastPersecpsecPackets Received Non-Unicast/sec is the rate at which non-unicast (subnet broadcast or subnet multicast) packets are delivered to a higher-layer protocol.
system_windows_network_interface_packetsReceivedUnicastPersecSystem Windows Network Interface PacketsReceivedUnicastPersecpsecPackets Received Unicast/sec is the rate at which (subnet) unicast packets are delivered to a higher-layer protocol.
system_windows_network_interface_packetsSentNonUnicastPersecSystem Windows Network Interface PacketsSentNonUnicastPersecpsecPackets Sent Non-Unicast/sec is the rate at which packets are requested to be transmitted to non-unicast (subnet broadcast or subnet multicast) addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
system_windows_network_interface_packetsSentUnicastPersecSystem Windows Network Interface PacketsSentUnicastPersecpsecPackets Sent Unicast/sec is the rate at which packets are requested to be transmitted to subnet-unicast addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
system_windows_network_interface_offloadedConnectionsSystem Windows Network Interface OffloadedConnectionscountOffloaded Connections is the number of TCP connections (over both IPv4 and IPv6) that are currently handled by the TCP chimney offload capable network adapter.
system_windows_network_interface_packetsOutboundErrorsSystem Windows Network Interface PacketsOutboundErrorscountPackets Outbound Errors is the number of outbound packets that could not be transmitted because of errors.
system_windows_network_interface_packetsReceivedErrorsSystem Windows Network Interface PacketsReceivedErrorscountPackets Received Errors is the number of inbound packets that contained errors preventing them from being deliverable to a higher-layer protocol.
system_windows_network_interface_outputQueueLengthSystem Windows Network Interface OutputQueueLengthcountOutput Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specification (NDIS) in this implementation, this will always be 0.
system_windows_network_interface_packetsReceivedDiscardedSystem Windows Network Interface PacketsReceivedDiscardedcountPackets Received Discarded is the number of inbound packets that were chosen to be discarded even though no errors had been detected to prevent their delivery to a higher-layer protocol. One possible reason for discarding packets could be to free up buffer space.
system_windows_network_interface_packetsOutboundDiscardedSystem Windows Network Interface PacketsOutboundDiscardedcountPackets Outbound Discarded is the number of outbound packets that were chosen to be discarded even though no errors had been detected to prevent transmission. One possible reason for discarding packets could be to free up buffer space.
system_windows_network_interface_utilizationSystem Windows Network Interface Utilization%Network Interface utilization in percentage.
system_windows_network_interface_trafficInSystem Windows Network Interface TrafficInbpsBytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\Bytes Received/sec is a subset of Network Interface\Bytes Total/sec.
system_windows_network_interface_trafficOutSystem Windows Network Interface TrafficOutbpsBytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\Bytes Sent/sec is a subset of Network Interface\Bytes Total/sec.
system_windows_network_interface_trafficTotalSystem Windows Network Interface TrafficTotalbpsBytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\Bytes Total/sec is a sum of Network Interface\Bytes Received/sec and Network Interface\Bytes Sent/sec.
system_windows_network_interface_packetsPersecSystem Windows Network Interface PacketsPersecpackets/secPackets/sec is the rate at which packets are sent and received on the network interface.

Agent G2 - Windows Network Interface Monitoring - v2

Description

Agent G2 - Windows Network Interface Monitoring - v2

Prerequisites

NULL

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Network Interface Monitoring - v2system.windows.network.interface.packets.received.persecSystem Windows Network Interface Packets Received Per Secpackets/secPacketsReceived/sec is the rate at which packets are received on the network interface.
system.windows.network.interface.packets.sent.persecSystem Windows Network Interface Packets Sent Per Secpackets/secPacketsSentPerSec is the rate at which packets are sent on the network interface.
system.windows.network.interface.traffic.outSystem Windows Network Interface Traffic OutbpsBytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.packets.persecSystem Windows Network Interface Packets Per Secpackets/secPackets/sec is the rate at which packets are sent and received on the network interface.
system.windows.network.interface.traffic.inSystem Windows Network Interface Traffic InbpsBytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.traffic.totalSystem Windows Network Interface Traffic TotalbpsBytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows Registry Monitoring

Description

Agent G2 - Windows Registry Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Registry Custom Monitorsystem.windows.registry.quota.usageSystem Windows Registry Quota Usage%% Registry Quota In Use is the percentage of the Total Registry Quota Allowed that is currently being used by the system. This counter displays the current percentage value only; it is not an average.

Agent G2 - Windows Services Monitoring

Description

Agent G2 - Windows Services Monitoring

Prerequisites

Provide ServiceNames with comma separated as input parameters while applying the template at device level.
Example: opsramp-agent,opsramp-shield,power.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Services Custom Monitorsystem.windows.service.statusSystem Windows Service StatusNULLIt gives the current status of the given service name(s), In graph 1 - Running & 0 - Stopped

Agent G2 - Windows Service Monitoring v2.0

Description

It monitors the windows service monitoring with Regex support.

Prerequisites

Provide service names as input arguments separated by commas when applying the template at the device level, along with support for regular expressions.

Syntax: serviceName1,serviceName2,regexPattern1,regexPattern2.

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Services Custom Monitor v2.0System_Windows_Service_Status_ExtSystem Windows Service Status ExtNULLIt gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Service Monitoring - v3

Description

To monitor the windows services status

Template Usage Guidelines:

  • When assigning this template on the device, users need to pass specific input parameters. These parameters should be provided as one or more service names (not the service display names) or service name regex patterns.
  • To provide multiple service names or service name regex patterns, seperate them with commas.
  • SAMPLE CUSTOM SCRIPT ARGUMENTS:
    Example 1(With regex): ^opsramp,agent$,Power
    Example 2(Without Regex): Netlogon,Dnscache,RpcEptMapper
Dell PowerFlex

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Services Custom Monitor - v3System_Windows_Service_Status_ExtSystem Windows Service Status ExtIt gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Mountpoint Monitoring

Description

Agent G2 - Windows Mountpoint Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor NameMetric NameMetric Display NameUnitDescription
Agent G2 - Windows Mountpoint Custom Monitorsystem.windows.mountpoint.disk.freespaceSystem Windows MountPoint Disk FreeSpaceMBShows the free space of mounted disks in MB.
system.windows.mountpoint.disk.usageSystem Windows MountPoint Disk Usage%Shows the utilization space of mounted disks in percentage.